Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8619_RS02530 | Genome accession | NZ_AP026918 |
| Coordinates | 485658..485807 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900700009 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 480658..490807
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8619_RS02495 (PC0009_04850) | blpU | 482574..482804 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| R8619_RS02500 | - | 482807..482926 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| R8619_RS02505 (PC0009_04860) | - | 483223..483387 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| R8619_RS02510 (PC0009_04870) | - | 483384..483788 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| R8619_RS02515 | - | 483986..484791 (+) | 806 | Protein_494 | IS5 family transposase | - |
| R8619_RS02520 (PC0009_04900) | blpM | 484941..485195 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| R8619_RS02525 (PC0009_04910) | blpN | 485211..485414 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| R8619_RS02530 (PC0009_04920) | cipB | 485658..485807 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| R8619_RS02535 | - | 485911..486030 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8619_RS02540 (PC0009_04940) | - | 486816..487199 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| R8619_RS02545 (PC0009_04950) | - | 487251..487940 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8619_RS02550 (PC0009_04960) | blpZ | 487982..488215 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| R8619_RS02555 | - | 488366..488977 (+) | 612 | WP_000394045.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8619_RS02560 (PC0009_04970) | ccrZ | 489138..489932 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| R8619_RS02565 (PC0009_04980) | trmB | 489929..490564 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=81811 R8619_RS02530 WP_001813641.1 485658..485807(+) (cipB) [Streptococcus pneumoniae strain PZ900700009]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=81811 R8619_RS02530 WP_001813641.1 485658..485807(+) (cipB) [Streptococcus pneumoniae strain PZ900700009]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |