Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8563_RS02535 | Genome accession | NZ_AP026917 |
| Coordinates | 491986..492135 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain PZ900700007 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 486986..497135
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8563_RS02485 (PC0007_04800) | blpI | 487898..488095 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| R8563_RS02490 (PC0007_04820) | blpJ | 488561..488830 (+) | 270 | WP_001093249.1 | bacteriocin-like peptide BlpJ | - |
| R8563_RS02500 (PC0007_04830) | - | 488899..489128 (+) | 230 | Protein_491 | Blp family class II bacteriocin | - |
| R8563_RS02505 | - | 489131..489250 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| R8563_RS02510 (PC0007_04840) | - | 489547..489711 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| R8563_RS02515 (PC0007_04850) | - | 489708..490112 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| R8563_RS02520 | - | 490315..491119 (+) | 805 | WP_151394153.1 | IS5 family transposase | - |
| R8563_RS02525 (PC0007_04880) | blpM | 491269..491523 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| R8563_RS02530 (PC0007_04890) | blpN | 491539..491742 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| R8563_RS02535 (PC0007_04900) | cipB | 491986..492135 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| R8563_RS10835 | - | 492171..492236 (+) | 66 | Protein_499 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| R8563_RS02540 | - | 492239..492358 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8563_RS02545 (PC0007_04920) | - | 493144..493527 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| R8563_RS02550 (PC0007_04930) | - | 493579..494268 (+) | 690 | WP_000760529.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8563_RS02555 (PC0007_04940) | blpZ | 494310..494543 (+) | 234 | WP_001849865.1 | immunity protein BlpZ | - |
| R8563_RS02560 | - | 494694..495305 (+) | 612 | WP_000394037.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8563_RS02565 (PC0007_04950) | ccrZ | 495466..496260 (+) | 795 | WP_000363010.1 | cell cycle regulator CcrZ | - |
| R8563_RS02570 (PC0007_04960) | trmB | 496257..496892 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=81694 R8563_RS02535 WP_001818346.1 491986..492135(+) (cipB) [Streptococcus pneumoniae strain PZ900700007]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=81694 R8563_RS02535 WP_001818346.1 491986..492135(+) (cipB) [Streptococcus pneumoniae strain PZ900700007]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |