Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   R3H37_RS07155 Genome accession   NZ_CP136948
Coordinates   1445034..1445252 (-) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain Spyo01     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1440034..1450252
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3H37_RS07125 (R3H37_07130) - 1440745..1441062 (-) 318 WP_002994587.1 hypothetical protein -
  R3H37_RS07130 (R3H37_07135) - 1441111..1441338 (-) 228 WP_028797129.1 Blp family class II bacteriocin -
  R3H37_RS07135 (R3H37_07140) - 1441736..1441864 (-) 129 WP_002994583.1 hypothetical protein -
  R3H37_RS09035 - 1441949..1442260 (-) 312 WP_227868558.1 CPBP family intramembrane glutamic endopeptidase -
  R3H37_RS07140 (R3H37_07145) - 1442555..1442731 (-) 177 WP_002994581.1 hypothetical protein -
  R3H37_RS07145 (R3H37_07150) - 1442709..1442933 (-) 225 WP_002994580.1 Blp family class II bacteriocin -
  R3H37_RS07150 (R3H37_07155) - 1443231..1444837 (+) 1607 Protein_1356 ABC transporter transmembrane domain-containing protein -
  R3H37_RS07155 (R3H37_07160) comE/blpR 1445034..1445252 (-) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  R3H37_RS07160 (R3H37_07165) - 1445553..1445807 (+) 255 WP_011106868.1 hypothetical protein -
  R3H37_RS07165 (R3H37_07170) - 1446113..1446589 (-) 477 WP_002985741.1 NUDIX hydrolase -
  R3H37_RS07170 (R3H37_07175) era 1446609..1447505 (-) 897 WP_002985743.1 GTPase Era -
  R3H37_RS07175 (R3H37_07180) - 1447625..1448032 (-) 408 WP_030126113.1 diacylglycerol kinase family protein -
  R3H37_RS07180 (R3H37_07185) ybeY 1448013..1448510 (-) 498 WP_002985748.1 rRNA maturation RNase YbeY -
  R3H37_RS07185 (R3H37_07190) - 1448669..1449244 (-) 576 WP_009880369.1 uracil-DNA glycosylase family protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=816470 R3H37_RS07155 WP_072135532.1 1445034..1445252(-) (comE/blpR) [Streptococcus pyogenes strain Spyo01]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=816470 R3H37_RS07155 WP_072135532.1 1445034..1445252(-) (comE/blpR) [Streptococcus pyogenes strain Spyo01]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417