Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   R3H37_RS00675 Genome accession   NZ_CP136948
Coordinates   105705..105989 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain Spyo01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 100705..110989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3H37_RS00650 (R3H37_00650) - 102651..103016 (+) 366 WP_002986560.1 DUF1033 family protein -
  R3H37_RS00655 (R3H37_00655) comGA 103109..104047 (+) 939 WP_023079010.1 competence type IV pilus ATPase ComGA Machinery gene
  R3H37_RS00660 (R3H37_00660) comGB 103983..105017 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  R3H37_RS00665 (R3H37_00665) comGC 105019..105345 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  R3H37_RS00670 (R3H37_00670) comGD 105320..105748 (+) 429 WP_129284411.1 competence type IV pilus minor pilin ComGD Machinery gene
  R3H37_RS00675 (R3H37_00675) comGE 105705..105989 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  R3H37_RS00680 (R3H37_00680) comGF 105982..106416 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  R3H37_RS00685 (R3H37_00685) comGG 106400..106726 (+) 327 WP_009880358.1 competence type IV pilus minor pilin ComGG -
  R3H37_RS00690 (R3H37_00690) comGH 106824..107777 (+) 954 WP_002987790.1 class I SAM-dependent methyltransferase Machinery gene
  R3H37_RS00695 (R3H37_00695) - 107836..109032 (+) 1197 WP_002987791.1 acetate kinase -
  R3H37_RS00700 (R3H37_00700) - 109218..109526 (+) 309 WP_030126458.1 hypothetical protein -
  R3H37_RS00705 (R3H37_00705) proC 109609..110379 (-) 771 WP_063631714.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=816405 R3H37_RS00675 WP_002987779.1 105705..105989(+) (comGE) [Streptococcus pyogenes strain Spyo01]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=816405 R3H37_RS00675 WP_002987779.1 105705..105989(+) (comGE) [Streptococcus pyogenes strain Spyo01]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383