Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinR   Type   Regulator
Locus tag   RJD36_RS10425 Genome accession   NZ_CP136943
Coordinates   2058559..2058768 (-) Length   69 a.a.
NCBI ID   WP_007286202.1    Uniprot ID   A0A810PUX2
Organism   Streptococcus pasteurianus strain WUSP082     
Function   repression of rok; repression of degU; repression of spo0A (predicted from homology)   
Competence regulation

Genomic Context

Location: 2053559..2063768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJD36_RS10380 (RJD36_10380) - 2053833..2054087 (-) 255 WP_002322727.1 helix-turn-helix domain-containing protein -
  RJD36_RS10385 (RJD36_10385) - 2054091..2054510 (-) 420 WP_003061815.1 RNA polymerase sigma factor -
  RJD36_RS10390 (RJD36_10390) - 2054805..2055065 (-) 261 Protein_1996 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
  RJD36_RS10395 (RJD36_10395) erm(B) 2055235..2055972 (-) 738 WP_002292226.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
  RJD36_RS10400 (RJD36_10400) - 2056097..2056180 (-) 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
  RJD36_RS10405 (RJD36_10405) - 2056201..2057043 (-) 843 WP_003060411.1 FtsX-like permease family protein -
  RJD36_RS10410 (RJD36_10410) - 2057033..2057802 (-) 770 Protein_2000 ABC transporter ATP-binding protein -
  RJD36_RS10415 (RJD36_10415) - 2057969..2058199 (-) 231 WP_003060191.1 hypothetical protein -
  RJD36_RS10420 (RJD36_10420) - 2058215..2058544 (-) 330 WP_003061243.1 DUF3784 domain-containing protein -
  RJD36_RS10425 (RJD36_10425) sinR 2058559..2058768 (-) 210 WP_007286202.1 helix-turn-helix transcriptional regulator Regulator
  RJD36_RS10430 (RJD36_10430) - 2058770..2059084 (-) 315 WP_003061887.1 DUF6442 family protein -
  RJD36_RS10435 (RJD36_10435) - 2059229..2060140 (-) 912 WP_317751247.1 conjugal transfer protein -
  RJD36_RS10440 (RJD36_10440) - 2060157..2061164 (-) 1008 WP_003059774.1 lysozyme family protein -
  RJD36_RS10445 (RJD36_10445) - 2061161..2063371 (-) 2211 WP_003060083.1 CD3337/EF1877 family mobilome membrane protein -

Sequence

Protein


Download         Length: 69 a.a.        Molecular weight: 7940.25 Da        Isoelectric Point: 8.0133

>NTDB_id=816369 RJD36_RS10425 WP_007286202.1 2058559..2058768(-) (sinR) [Streptococcus pasteurianus strain WUSP082]
MDEHLILRNRLKTVRKEKKLSQTELAELVGVSRNTVSSIETGQFNPTAKLALVLCIALDKKFEELFYFD

Nucleotide


Download         Length: 210 bp        

>NTDB_id=816369 RJD36_RS10425 WP_007286202.1 2058559..2058768(-) (sinR) [Streptococcus pasteurianus strain WUSP082]
ATGGACGAACATTTAATTTTGCGAAACAGATTAAAAACTGTACGAAAAGAAAAAAAATTATCACAAACAGAATTAGCTGA
ACTAGTCGGGGTTTCTCGGAATACAGTTAGTTCTATTGAAACTGGACAATTTAATCCAACAGCAAAATTGGCATTAGTGC
TTTGTATAGCTTTAGATAAAAAATTTGAAGAATTATTTTATTTTGATTAA

Domains

Predicted by InterProScan.

Helix-turn-helix (HTH_3)

(11-65)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A810PUX2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinR Bacillus subtilis subsp. subtilis str. 168

40.299

97.101

0.391