Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   QA442_RS08810 Genome accession   NZ_CP121861
Coordinates   1694138..1694548 (+) Length   136 a.a.
NCBI ID   WP_279474033.1    Uniprot ID   -
Organism   Bacillus stercoris strain Mal05     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1652618..1693194 1694138..1694548 flank 944


Gene organization within MGE regions


Location: 1652618..1694548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QA442_RS08545 (QA442_08545) - 1652618..1653655 (+) 1038 WP_095432890.1 NAD(P)/FAD-dependent oxidoreductase -
  QA442_RS08550 (QA442_08550) - 1653940..1654629 (-) 690 Protein_1648 DUF1259 domain-containing protein -
  QA442_RS08555 (QA442_08555) - 1654625..1655145 (+) 521 Protein_1649 FUSC family protein -
  QA442_RS08560 (QA442_08560) - 1655213..1656247 (+) 1035 WP_095432891.1 XdhC/CoxI family protein -
  QA442_RS08565 (QA442_08565) - 1656244..1656864 (+) 621 WP_095432892.1 NTP transferase domain-containing protein -
  QA442_RS08570 (QA442_08570) - 1656870..1659200 (+) 2331 WP_095432893.1 xanthine dehydrogenase family protein molybdopterin-binding subunit -
  QA442_RS08575 (QA442_08575) - 1659187..1660029 (+) 843 WP_095432894.1 FAD binding domain-containing protein -
  QA442_RS08580 (QA442_08580) - 1660022..1660486 (+) 465 WP_040082384.1 (2Fe-2S)-binding protein -
  QA442_RS08585 (QA442_08585) - 1660690..1661148 (-) 459 WP_095432895.1 GNAT family N-acetyltransferase -
  QA442_RS08590 (QA442_08590) blt 1661348..1662550 (-) 1203 WP_095432896.1 multidrug efflux MFS transporter Blt -
  QA442_RS08595 (QA442_08595) bltR 1662661..1663482 (+) 822 WP_095432897.1 multidrug efflux transcriptional regulator BltR -
  QA442_RS08600 (QA442_08600) - 1663553..1663702 (+) 150 Protein_1658 N-acetylmuramoyl-L-alanine amidase -
  QA442_RS08605 (QA442_08605) - 1663902..1664645 (-) 744 WP_095432898.1 SDR family oxidoreductase -
  QA442_RS08610 (QA442_08610) - 1664930..1665307 (-) 378 WP_069839547.1 MerR family transcriptional regulator -
  QA442_RS08615 (QA442_08615) - 1665476..1665804 (-) 329 Protein_1661 SMI1/KNR4 family protein -
  QA442_RS08620 (QA442_08620) - 1666232..1666519 (-) 288 WP_069839546.1 DUF1330 domain-containing protein -
  QA442_RS08625 (QA442_08625) - 1666678..1667586 (+) 909 WP_095432899.1 LysR family transcriptional regulator -
  QA442_RS08630 (QA442_08630) - 1667781..1668467 (+) 687 WP_069839544.1 GntR family transcriptional regulator -
  QA442_RS08635 (QA442_08635) ilvD 1668460..1670154 (+) 1695 WP_069839543.1 dihydroxy-acid dehydratase -
  QA442_RS08640 (QA442_08640) - 1670407..1670777 (-) 371 Protein_1666 aspartate phosphatase -
  QA442_RS08645 (QA442_08645) - 1670912..1671028 (+) 117 WP_139123539.1 hypothetical protein -
  QA442_RS08650 (QA442_08650) - 1671264..1671824 (+) 561 WP_279474018.1 cupin domain-containing protein -
  QA442_RS08655 (QA442_08655) - 1672184..1672501 (+) 318 WP_095432901.1 sulfurtransferase -
  QA442_RS08660 (QA442_08660) - 1672523..1672783 (+) 261 WP_003237170.1 metal-sensitive transcriptional regulator -
  QA442_RS08665 (QA442_08665) - 1672931..1673413 (+) 483 WP_095432902.1 DsrE/DsrF/DrsH-like family protein -
  QA442_RS08670 (QA442_08670) - 1673460..1673828 (+) 369 WP_069839540.1 rhodanese-like domain-containing protein -
  QA442_RS08675 (QA442_08675) - 1673894..1674463 (+) 570 WP_095432903.1 sulfurtransferase TusA family protein -
  QA442_RS08680 (QA442_08680) - 1674429..1675593 (+) 1165 Protein_1674 MBL fold metallo-hydrolase -
  QA442_RS08685 (QA442_08685) - 1675627..1675854 (+) 228 WP_014664707.1 sulfurtransferase TusA family protein -
  QA442_RS08690 (QA442_08690) - 1675914..1676690 (+) 777 WP_095432904.1 sulfite exporter TauE/SafE family protein -
  QA442_RS08695 (QA442_08695) - 1677020..1677346 (-) 327 WP_095432905.1 DUF255 domain-containing protein -
  QA442_RS08700 (QA442_08700) - 1677988..1678197 (-) 210 Protein_1678 ImmA/IrrE family metallo-endopeptidase -
  QA442_RS08705 (QA442_08705) - 1678466..1679002 (+) 537 WP_279474022.1 AAA family ATPase -
  QA442_RS08710 (QA442_08710) - 1679195..1679737 (-) 543 WP_095432942.1 PadR family transcriptional regulator -
  QA442_RS08715 (QA442_08715) - 1679734..1680576 (-) 843 WP_095432941.1 sialate O-acetylesterase -
  QA442_RS08720 (QA442_08720) - 1680923..1681324 (+) 402 WP_095432940.1 hypothetical protein -
  QA442_RS08725 (QA442_08725) - 1681484..1681786 (+) 303 Protein_1683 ATP-binding protein -
  QA442_RS22145 - 1681786..1682082 (+) 297 Protein_1684 LysM peptidoglycan-binding domain-containing protein -
  QA442_RS08740 (QA442_08740) - 1682324..1682647 (-) 324 WP_095432939.1 hypothetical protein -
  QA442_RS08745 (QA442_08745) - 1682772..1683902 (+) 1131 WP_279474024.1 amidase domain-containing protein -
  QA442_RS08750 (QA442_08750) - 1684322..1684575 (+) 254 Protein_1687 peptidoglycan-binding domain-containing protein -
  QA442_RS08755 (QA442_08755) - 1684686..1684964 (-) 279 WP_095432937.1 hypothetical protein -
  QA442_RS08760 (QA442_08760) - 1684961..1685285 (-) 325 Protein_1689 tRNA-Val4 -
  QA442_RS08765 (QA442_08765) cdiI 1685331..1685690 (-) 360 WP_095432943.1 ribonuclease toxin immunity protein CdiI -
  QA442_RS08770 (QA442_08770) - 1685787..1686239 (-) 453 WP_019260159.1 SMI1/KNR4 family protein -
  QA442_RS08775 (QA442_08775) - 1686251..1688085 (-) 1835 Protein_1692 T7SS effector LXG polymorphic toxin -
  QA442_RS08780 (QA442_08780) phrE 1688309..1688443 (-) 135 WP_014114495.1 phosphatase RapE inhibitor PhrE -
  QA442_RS08785 (QA442_08785) rapE 1688433..1689560 (-) 1128 WP_069839531.1 response regulator aspartate phosphatase RapE -
  QA442_RS08790 (QA442_08790) - 1689958..1691511 (+) 1554 WP_103750527.1 hypothetical protein -
  QA442_RS08795 (QA442_08795) - 1692000..1692620 (+) 621 WP_095432930.1 hypothetical protein -
  QA442_RS08800 (QA442_08800) - 1692876..1693050 (+) 175 Protein_1697 hypothetical protein -
  QA442_RS08805 (QA442_08805) sigK 1693213..1693941 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  QA442_RS08810 (QA442_08810) nucA/comI 1694138..1694548 (+) 411 WP_279474033.1 sporulation-specific Dnase NucB Machinery gene

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 15016.02 Da        Isoelectric Point: 4.9203

>NTDB_id=814897 QA442_RS08810 WP_279474033.1 1694138..1694548(+) (nucA/comI) [Bacillus stercoris strain Mal05]
MKKWMAGLFLAAAVLLCVMVPQQIQGASLYDKVLYFPLSRYTETGDHIRDAIAEGHSEICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=814897 QA442_RS08810 WP_279474033.1 1694138..1694548(+) (nucA/comI) [Bacillus stercoris strain Mal05]
ATGAAAAAATGGATGGCAGGCTTGTTTCTTGCTGCAGCAGTTCTTCTTTGTGTAATGGTTCCGCAGCAGATCCAAGGCGC
TTCTTTGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATACGGAAACAGGCGATCATATTAGAGATGCGATTGCAG
AGGGACATTCTGAGATTTGCACCATAGATAGAGATGGAGCAGACAAAAGGCGGGAGGAATCATTAAAGGGTATTCCGACG
AAGCCGGGCTATGATCGGGATGAGTGGCCGATGGCAGTCTGCGAGGAAGGCGGCGCAGGAGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGGGCCGGCTCATGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(42-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

63.478

84.559

0.537