Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   P8R49_RS13335 Genome accession   NZ_CP121266
Coordinates   2468646..2469056 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain 107105     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2461750..2498801 2468646..2469056 within 0


Gene organization within MGE regions


Location: 2461750..2498801
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8R49_RS13295 (P8R49_13295) yqeH 2461750..2462850 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  P8R49_RS13300 (P8R49_13300) yqeG 2462854..2463372 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  P8R49_RS13305 (P8R49_13305) - 2463734..2463874 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  P8R49_RS13310 (P8R49_13310) yqeF 2464180..2464911 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  P8R49_RS13315 (P8R49_13315) cwlH 2465163..2465915 (-) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  P8R49_RS13320 (P8R49_13320) yqeD 2466102..2466728 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  P8R49_RS13325 (P8R49_13325) gnd 2466747..2467640 (-) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  P8R49_RS13330 (P8R49_13330) yqeB 2467891..2468613 (+) 723 WP_014480321.1 hypothetical protein -
  P8R49_RS13335 (P8R49_13335) nucA/comI 2468646..2469056 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  P8R49_RS13340 (P8R49_13340) sigK 2469252..2469980 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  P8R49_RS13345 (P8R49_13345) - 2469980..2470078 (+) 99 WP_031600702.1 hypothetical protein -
  P8R49_RS13350 (P8R49_13350) - 2470075..2470287 (-) 213 Protein_2579 recombinase family protein -
  P8R49_RS13355 (P8R49_13355) fumC 2470506..2471894 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  P8R49_RS13360 (P8R49_13360) - 2472061..2472951 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  P8R49_RS13365 (P8R49_13365) - 2473893..2474288 (+) 396 WP_014480327.1 VOC family protein -
  P8R49_RS13375 (P8R49_13375) - 2475028..2476155 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  P8R49_RS13380 (P8R49_13380) - 2476337..2478263 (+) 1927 Protein_2584 T7SS effector LXG polymorphic toxin -
  P8R49_RS13385 (P8R49_13385) - 2478277..2478564 (+) 288 WP_014480331.1 hypothetical protein -
  P8R49_RS13390 (P8R49_13390) - 2478967..2479407 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  P8R49_RS13395 (P8R49_13395) - 2479506..2479958 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  P8R49_RS13400 (P8R49_13400) cdiI 2480055..2480414 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  P8R49_RS13405 (P8R49_13405) - 2480519..2480998 (+) 480 WP_224588637.1 hypothetical protein -
  P8R49_RS13410 (P8R49_13410) - 2481306..2481509 (-) 204 WP_123772462.1 hypothetical protein -
  P8R49_RS13415 (P8R49_13415) - 2481598..2481831 (+) 234 WP_224588641.1 hypothetical protein -
  P8R49_RS13420 (P8R49_13420) atxG 2482099..2482676 (+) 578 Protein_2592 suppressor of fused domain protein -
  P8R49_RS13425 (P8R49_13425) - 2482786..2483076 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  P8R49_RS13430 (P8R49_13430) istA 2483917..2485464 (+) 1548 WP_014480339.1 IS21 family transposase -
  P8R49_RS13435 (P8R49_13435) istB 2485461..2486219 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  P8R49_RS13440 (P8R49_13440) - 2486537..2486634 (-) 98 Protein_2596 N-acetylmuramoyl-L-alanine amidase -
  P8R49_RS13445 (P8R49_13445) - 2486812..2486898 (+) 87 WP_072592549.1 putative holin-like toxin -
  P8R49_RS22510 - 2487185..2487621 (-) 437 Protein_2598 phage tail tube protein -
  P8R49_RS13460 (P8R49_13460) terS 2487619..2488184 (-) 566 Protein_2599 phage terminase small subunit -
  P8R49_RS13465 (P8R49_13465) - 2488311..2488616 (+) 306 WP_123772463.1 hypothetical protein -
  P8R49_RS13470 (P8R49_13470) - 2488789..2488854 (-) 66 Protein_2601 hypothetical protein -
  P8R49_RS13475 (P8R49_13475) - 2489009..2489488 (-) 480 WP_014480344.1 hypothetical protein -
  P8R49_RS13480 (P8R49_13480) - 2490105..2490371 (+) 267 WP_033881358.1 hypothetical protein -
  P8R49_RS13485 (P8R49_13485) - 2490510..2490662 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  P8R49_RS13490 (P8R49_13490) - 2490745..2490867 (-) 123 Protein_2605 RusA family crossover junction endodeoxyribonuclease -
  P8R49_RS13495 (P8R49_13495) - 2490830..2491078 (-) 249 Protein_2606 hypothetical protein -
  P8R49_RS13500 (P8R49_13500) - 2491223..2491453 (-) 231 WP_224588644.1 hypothetical protein -
  P8R49_RS13505 (P8R49_13505) - 2491762..2491942 (-) 181 Protein_2608 hypothetical protein -
  P8R49_RS13510 (P8R49_13510) bltR 2492150..2492971 (-) 822 WP_014480349.1 multidrug efflux transcriptional regulator BltR -
  P8R49_RS13515 (P8R49_13515) blt 2493088..2494290 (+) 1203 WP_014480350.1 multidrug efflux MFS transporter Blt -
  P8R49_RS13520 (P8R49_13520) bltD 2494472..2494930 (+) 459 WP_014480351.1 spermine/spermidine acetyltransferase -
  P8R49_RS13525 (P8R49_13525) yrkA 2495089..2496393 (-) 1305 WP_014480352.1 hemolysin family protein -
  P8R49_RS13530 (P8R49_13530) yrzO 2496683..2496826 (-) 144 WP_014477437.1 YrzO family protein -
  P8R49_RS13535 (P8R49_13535) yrdR 2496844..2497809 (-) 966 WP_014480354.1 DMT family transporter -
  P8R49_RS13540 (P8R49_13540) czcR 2497935..2498801 (+) 867 WP_014480355.1 LysR family transcriptional regulator CzcR -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=811527 P8R49_RS13335 WP_009967785.1 2468646..2469056(-) (nucA/comI) [Bacillus subtilis strain 107105]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=811527 P8R49_RS13335 WP_009967785.1 2468646..2469056(-) (nucA/comI) [Bacillus subtilis strain 107105]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529