Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P3X35_RS13095 Genome accession   NZ_CP120920
Coordinates   2634996..2635172 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain SYN-191     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2629996..2640172
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3X35_RS13080 (P3X35_13080) gcvT 2630636..2631730 (-) 1095 WP_079289191.1 glycine cleavage system aminomethyltransferase GcvT -
  P3X35_RS13085 (P3X35_13085) - 2632325..2634004 (+) 1680 WP_020452163.1 SNF2-related protein -
  P3X35_RS13090 (P3X35_13090) - 2634011..2634805 (+) 795 WP_020452164.1 YqhG family protein -
  P3X35_RS13095 (P3X35_13095) sinI 2634996..2635172 (+) 177 WP_020452165.1 anti-repressor SinI family protein Regulator
  P3X35_RS13100 (P3X35_13100) sinR 2635206..2635541 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  P3X35_RS13105 (P3X35_13105) - 2635646..2636440 (-) 795 WP_020452167.1 TasA family protein -
  P3X35_RS13110 (P3X35_13110) - 2636513..2637097 (-) 585 WP_065644169.1 signal peptidase I -
  P3X35_RS13115 (P3X35_13115) tapA 2637094..2637822 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  P3X35_RS13120 (P3X35_13120) - 2638100..2638420 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  P3X35_RS13125 (P3X35_13125) - 2638450..2638632 (-) 183 WP_020452171.1 YqzE family protein -
  P3X35_RS13130 (P3X35_13130) comGG 2638721..2639086 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  P3X35_RS13135 (P3X35_13135) comGF 2639098..2639586 (-) 489 WP_236613657.1 competence type IV pilus minor pilin ComGF -
  P3X35_RS13140 (P3X35_13140) comGE 2639495..2639842 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=809281 P3X35_RS13095 WP_020452165.1 2634996..2635172(+) (sinI) [Bacillus paralicheniformis strain SYN-191]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=809281 P3X35_RS13095 WP_020452165.1 2634996..2635172(+) (sinI) [Bacillus paralicheniformis strain SYN-191]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5