Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P0M29_RS08060 Genome accession   NZ_CP120711
Coordinates   1558797..1558937 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 12Y     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1553797..1563937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P0M29_RS08035 (P0M29_08035) - 1554137..1554520 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  P0M29_RS08040 (P0M29_08040) comA 1554542..1555186 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  P0M29_RS08045 (P0M29_08045) comP 1555267..1557558 (-) 2292 WP_029973797.1 histidine kinase Regulator
  P0M29_RS08050 (P0M29_08050) comX 1557570..1557734 (-) 165 WP_007613432.1 competence pheromone ComX -
  P0M29_RS08055 (P0M29_08055) - 1557734..1558612 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  P0M29_RS08060 (P0M29_08060) degQ 1558797..1558937 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  P0M29_RS08065 (P0M29_08065) - 1559403..1559744 (+) 342 WP_014418765.1 hypothetical protein -
  P0M29_RS08070 (P0M29_08070) - 1559751..1560974 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  P0M29_RS08075 (P0M29_08075) - 1561104..1562570 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  P0M29_RS08080 (P0M29_08080) - 1562588..1563139 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  P0M29_RS08085 (P0M29_08085) - 1563236..1563634 (-) 399 WP_029973800.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=808172 P0M29_RS08060 WP_003152043.1 1558797..1558937(-) (degQ) [Bacillus velezensis strain 12Y]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=808172 P0M29_RS08060 WP_003152043.1 1558797..1558937(-) (degQ) [Bacillus velezensis strain 12Y]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891