Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | P5655_RS11080 | Genome accession | NZ_CP120681 |
| Coordinates | 2017113..2017523 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain DSM 10 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2010216..2063968 | 2017113..2017523 | within | 0 |
Gene organization within MGE regions
Location: 2010216..2063968
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5655_RS11040 (P5655_11040) | yqeH | 2010216..2011316 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| P5655_RS11045 (P5655_11045) | yqeG | 2011320..2011838 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| P5655_RS11050 (P5655_11050) | - | 2012200..2012340 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| P5655_RS11055 (P5655_11055) | yqeF | 2012646..2013377 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| P5655_RS11060 (P5655_11060) | cwlH | 2013629..2014381 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| P5655_RS11065 (P5655_11065) | yqeD | 2014568..2015194 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| P5655_RS11070 (P5655_11070) | gnd | 2015213..2016106 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| P5655_RS11075 (P5655_11075) | yqeB | 2016358..2017080 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| P5655_RS11080 (P5655_11080) | nucA/comI | 2017113..2017523 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| P5655_RS11085 (P5655_11085) | - | 2017719..2018065 (+) | 347 | Protein_2086 | sigma-70 family RNA polymerase sigma factor | - |
| P5655_RS11090 (P5655_11090) | spoIVCA | 2018096..2019556 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| P5655_RS11095 (P5655_11095) | - | 2019514..2019692 (-) | 179 | Protein_2088 | hypothetical protein | - |
| P5655_RS11100 (P5655_11100) | arsC | 2020047..2020466 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| P5655_RS11105 (P5655_11105) | acr3 | 2020478..2021518 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| P5655_RS11110 (P5655_11110) | arsK | 2021541..2021981 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| P5655_RS11115 (P5655_11115) | arsR | 2022042..2022359 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| P5655_RS11120 (P5655_11120) | yqcI | 2022731..2023495 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| P5655_RS11125 (P5655_11125) | rapE | 2023938..2025065 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| P5655_RS11130 (P5655_11130) | phrE | 2025055..2025189 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| P5655_RS11135 (P5655_11135) | - | 2025299..2025457 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| P5655_RS11140 (P5655_11140) | yqcG | 2025827..2027422 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| P5655_RS11145 (P5655_11145) | yqcF | 2027437..2028015 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| P5655_RS11150 (P5655_11150) | - | 2028133..2028279 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| P5655_RS11155 (P5655_11155) | - | 2028276..2028638 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| P5655_RS11160 (P5655_11160) | - | 2028654..2029133 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| P5655_RS11165 (P5655_11165) | cwlA | 2029298..2030116 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| P5655_RS11170 (P5655_11170) | skhD | 2030161..2030583 (-) | 423 | WP_003246208.1 | holin family protein | - |
| P5655_RS11175 (P5655_11175) | xepAK | 2030628..2031521 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| P5655_RS11180 (P5655_11180) | yqcE | 2031609..2031773 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| P5655_RS11185 (P5655_11185) | yqcD | 2031770..2032105 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| P5655_RS11190 (P5655_11190) | yqcC | 2032115..2033215 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| P5655_RS11195 (P5655_11195) | - | 2033218..2033490 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| P5655_RS11200 (P5655_11200) | yqcA | 2033487..2034065 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| P5655_RS11205 (P5655_11205) | yqbT | 2034049..2035095 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| P5655_RS11210 (P5655_11210) | yqbS | 2035088..2035513 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| P5655_RS11215 (P5655_11215) | yqbR | 2035526..2035789 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| P5655_RS11220 (P5655_11220) | yqbQ | 2035786..2036766 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| P5655_RS11225 (P5655_11225) | yqbP | 2036779..2037438 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| P5655_RS11230 (P5655_11230) | yqbO | 2037431..2042188 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| P5655_RS11235 (P5655_11235) | - | 2042191..2042328 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| P5655_RS11240 (P5655_11240) | - | 2042370..2042819 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| P5655_RS11245 (P5655_11245) | txpA | 2042965..2043144 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| P5655_RS11250 (P5655_11250) | bsrH | 2043524..2043613 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| P5655_RS11255 (P5655_11255) | yqbM | 2043867..2044310 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| P5655_RS11260 (P5655_11260) | yqbK | 2044313..2045713 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| P5655_RS11265 (P5655_11265) | - | 2045714..2045905 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| P5655_RS11270 (P5655_11270) | yqbJ | 2045902..2046339 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| P5655_RS11275 (P5655_11275) | yqbI | 2046352..2046855 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| P5655_RS11280 (P5655_11280) | yqbH | 2046852..2047214 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| P5655_RS11285 (P5655_11285) | gkpG | 2047211..2047606 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| P5655_RS11290 (P5655_11290) | yqbF | 2047610..2047921 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| P5655_RS11295 (P5655_11295) | skdG | 2047932..2048867 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| P5655_RS11300 (P5655_11300) | yqbD | 2048886..2049854 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| P5655_RS11305 (P5655_11305) | - | 2049887..2050540 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| P5655_RS11310 (P5655_11310) | yqbB | 2050581..2051498 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| P5655_RS11315 (P5655_11315) | yqbA | 2051495..2053027 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| P5655_RS11320 (P5655_11320) | stmB | 2053031..2054326 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| P5655_RS11325 (P5655_11325) | terS | 2054319..2055038 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| P5655_RS11330 (P5655_11330) | - | 2055106..2055570 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| P5655_RS11335 (P5655_11335) | yqaQ | 2055714..2056169 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| P5655_RS11340 (P5655_11340) | - | 2056367..2057296 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| P5655_RS11345 (P5655_11345) | yqaO | 2057370..2057576 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| P5655_RS11350 (P5655_11350) | yqaN | 2057658..2058086 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P5655_RS11355 (P5655_11355) | - | 2058182..2058331 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| P5655_RS11360 (P5655_11360) | sknM | 2058322..2059263 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| P5655_RS11365 (P5655_11365) | yqaL | 2059145..2059822 (-) | 678 | WP_010886575.1 | DnaD domain protein | - |
| P5655_RS11370 (P5655_11370) | recT | 2059898..2060752 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| P5655_RS11375 (P5655_11375) | yqaJ | 2060755..2061714 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| P5655_RS11380 (P5655_11380) | - | 2061820..2062014 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| P5655_RS11385 (P5655_11385) | - | 2061974..2062147 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| P5655_RS11390 (P5655_11390) | sknH | 2062144..2062401 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| P5655_RS11395 (P5655_11395) | yqaG | 2062398..2062967 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| P5655_RS11400 (P5655_11400) | - | 2063041..2063181 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| P5655_RS11405 (P5655_11405) | yqaF | 2063211..2063441 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| P5655_RS11410 (P5655_11410) | sknR | 2063618..2063968 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=807748 P5655_RS11080 WP_009967785.1 2017113..2017523(-) (nucA/comI) [Bacillus subtilis strain DSM 10]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=807748 P5655_RS11080 WP_009967785.1 2017113..2017523(-) (nucA/comI) [Bacillus subtilis strain DSM 10]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |