Detailed information
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | HXS57_RS01400 | Genome accession | NZ_AP023039 |
| Coordinates | 268768..269031 (+) | Length | 87 a.a. |
| NCBI ID | WP_034375715.1 | Uniprot ID | - |
| Organism | Helicobacter suis strain NHP19-4003 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 268482..309221 | 268768..269031 | within | 0 |
Gene organization within MGE regions
Location: 268482..309221
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXS57_RS01395 (NHP194003_02850) | comB2 | 268518..268757 (+) | 240 | WP_050780158.1 | TrbC/VirB2 family protein | Machinery gene |
| HXS57_RS01400 (NHP194003_02860) | comB3 | 268768..269031 (+) | 264 | WP_034375715.1 | hypothetical protein | Machinery gene |
| HXS57_RS01405 (NHP194003_02870) | - | 269051..269371 (+) | 321 | WP_034375717.1 | hypothetical protein | - |
| HXS57_RS01410 (NHP194003_02880) | comB4 | 269384..271819 (+) | 2436 | WP_176485805.1 | VirB4 family type IV secretion/conjugal transfer ATPase | Machinery gene |
| HXS57_RS09360 (NHP194003_02890) | - | 271824..272033 (+) | 210 | WP_141556969.1 | hypothetical protein | - |
| HXS57_RS01420 (NHP194003_02900) | - | 272043..273134 (+) | 1092 | WP_050780156.1 | type IV secretion system protein | - |
| HXS57_RS01425 (NHP194003_02910) | - | 273131..274660 (+) | 1530 | WP_006564108.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HXS57_RS01430 (NHP194003_02920) | - | 274650..275908 (+) | 1259 | Protein_296 | DNA type IV secretion system protein ComB10 | - |
| HXS57_RS01435 (NHP194003_02940) | - | 275928..278069 (+) | 2142 | WP_232087234.1 | collagen-like protein | - |
| HXS57_RS01440 (NHP194003_02950) | - | 278089..279066 (+) | 978 | WP_232088061.1 | hypothetical protein | - |
| HXS57_RS01445 (NHP194003_02960) | - | 279078..279353 (+) | 276 | WP_050782209.1 | hypothetical protein | - |
| HXS57_RS01450 (NHP194003_02970) | - | 279518..280600 (+) | 1083 | WP_073193814.1 | RNA-guided endonuclease InsQ/TnpB family protein | - |
| HXS57_RS01455 (NHP194003_02980) | - | 280614..281075 (+) | 462 | WP_073115515.1 | hypothetical protein | - |
| HXS57_RS01460 (NHP194003_02990) | - | 281140..282993 (+) | 1854 | WP_176485806.1 | type IV secretory system conjugative DNA transfer family protein | - |
| HXS57_RS01465 (NHP194003_03000) | - | 282995..291622 (+) | 8628 | WP_176485807.1 | SNF2-related protein | - |
| HXS57_RS01470 (NHP194003_03010) | - | 291661..293718 (+) | 2058 | WP_104707183.1 | type IA DNA topoisomerase | - |
| HXS57_RS01475 (NHP194003_03020) | - | 293734..295023 (+) | 1290 | WP_006565021.1 | high persistence protein | - |
| HXS57_RS01480 (NHP194003_03030) | - | 295246..296022 (+) | 777 | WP_034375242.1 | Fic family protein | - |
| HXS57_RS01485 (NHP194003_03040) | - | 296164..296718 (+) | 555 | WP_006564987.1 | hypothetical protein | - |
| HXS57_RS01490 (NHP194003_03050) | - | 296730..296975 (+) | 246 | WP_006563801.1 | ribbon-helix-helix domain-containing protein | - |
| HXS57_RS01495 (NHP194003_03060) | - | 297431..297646 (+) | 216 | WP_034375112.1 | hypothetical protein | - |
| HXS57_RS01500 (NHP194003_03070) | - | 297680..298249 (+) | 570 | WP_050782144.1 | ArdC-like ssDNA-binding domain-containing protein | - |
| HXS57_RS01505 (NHP194003_03080) | - | 298254..298796 (+) | 543 | WP_104705678.1 | hypothetical protein | - |
| HXS57_RS01510 (NHP194003_03090) | - | 298809..299618 (+) | 810 | WP_231102946.1 | Fic family protein | - |
| HXS57_RS01515 (NHP194003_03100) | - | 299691..301184 (+) | 1494 | WP_141556959.1 | hypothetical protein | - |
| HXS57_RS01520 (NHP194003_03110) | - | 301184..303106 (+) | 1923 | WP_034375116.1 | hypothetical protein | - |
| HXS57_RS01525 (NHP194003_03120) | - | 303096..304421 (+) | 1326 | WP_176485808.1 | type IV secretion system protein | - |
| HXS57_RS01530 (NHP194003_03130) | - | 304445..305209 (-) | 765 | WP_064430254.1 | Fic family protein | - |
| HXS57_RS01535 (NHP194003_03140) | - | 305287..305973 (+) | 687 | WP_143159247.1 | hypothetical protein | - |
| HXS57_RS01540 (NHP194003_03150) | - | 305970..307280 (-) | 1311 | WP_232088062.1 | hypothetical protein | - |
| HXS57_RS01545 (NHP194003_03160) | - | 308154..309221 (+) | 1068 | WP_034375873.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9910.98 Da Isoelectric Point: 8.9498
>NTDB_id=80766 HXS57_RS01400 WP_034375715.1 268768..269031(+) (comB3) [Helicobacter suis strain NHP19-4003]
MQVVQVSVPNLREISSKEKFLWLNAKSFLICLLVPFVLLPTIGVLYALLLYGVLLLVFSILEFFDEDISDILVARSKIKT
KSTKFYA
MQVVQVSVPNLREISSKEKFLWLNAKSFLICLLVPFVLLPTIGVLYALLLYGVLLLVFSILEFFDEDISDILVARSKIKT
KSTKFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=80766 HXS57_RS01400 WP_034375715.1 268768..269031(+) (comB3) [Helicobacter suis strain NHP19-4003]
ATGCAAGTTGTGCAGGTGAGTGTGCCTAATCTAAGAGAAATCTCTAGCAAAGAAAAATTCTTATGGCTCAATGCCAAAAG
TTTTTTAATCTGCTTGCTTGTGCCCTTCGTGTTACTACCCACTATTGGAGTCTTATATGCCTTGCTGCTCTATGGTGTGC
TTTTATTAGTGTTTAGCATTTTAGAATTTTTTGATGAAGACATTAGCGATATTCTAGTTGCGCGCTCTAAAATCAAAACT
AAGAGCACAAAATTTTATGCGTGA
ATGCAAGTTGTGCAGGTGAGTGTGCCTAATCTAAGAGAAATCTCTAGCAAAGAAAAATTCTTATGGCTCAATGCCAAAAG
TTTTTTAATCTGCTTGCTTGTGCCCTTCGTGTTACTACCCACTATTGGAGTCTTATATGCCTTGCTGCTCTATGGTGTGC
TTTTATTAGTGTTTAGCATTTTAGAATTTTTTGATGAAGACATTAGCGATATTCTAGTTGCGCGCTCTAAAATCAAAACT
AAGAGCACAAAATTTTATGCGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
63.218 |
100 |
0.632 |