Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB2   Type   Machinery gene
Locus tag   HXS57_RS01395 Genome accession   NZ_AP023039
Coordinates   268518..268757 (+) Length   79 a.a.
NCBI ID   WP_050780158.1    Uniprot ID   -
Organism   Helicobacter suis strain NHP19-4003     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 268482..309221 268518..268757 within 0


Gene organization within MGE regions


Location: 268482..309221
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HXS57_RS01395 (NHP194003_02850) comB2 268518..268757 (+) 240 WP_050780158.1 TrbC/VirB2 family protein Machinery gene
  HXS57_RS01400 (NHP194003_02860) comB3 268768..269031 (+) 264 WP_034375715.1 hypothetical protein Machinery gene
  HXS57_RS01405 (NHP194003_02870) - 269051..269371 (+) 321 WP_034375717.1 hypothetical protein -
  HXS57_RS01410 (NHP194003_02880) comB4 269384..271819 (+) 2436 WP_176485805.1 VirB4 family type IV secretion/conjugal transfer ATPase Machinery gene
  HXS57_RS09360 (NHP194003_02890) - 271824..272033 (+) 210 WP_141556969.1 hypothetical protein -
  HXS57_RS01420 (NHP194003_02900) - 272043..273134 (+) 1092 WP_050780156.1 type IV secretion system protein -
  HXS57_RS01425 (NHP194003_02910) - 273131..274660 (+) 1530 WP_006564108.1 TrbG/VirB9 family P-type conjugative transfer protein -
  HXS57_RS01430 (NHP194003_02920) - 274650..275908 (+) 1259 Protein_296 DNA type IV secretion system protein ComB10 -
  HXS57_RS01435 (NHP194003_02940) - 275928..278069 (+) 2142 WP_232087234.1 collagen-like protein -
  HXS57_RS01440 (NHP194003_02950) - 278089..279066 (+) 978 WP_232088061.1 hypothetical protein -
  HXS57_RS01445 (NHP194003_02960) - 279078..279353 (+) 276 WP_050782209.1 hypothetical protein -
  HXS57_RS01450 (NHP194003_02970) - 279518..280600 (+) 1083 WP_073193814.1 RNA-guided endonuclease InsQ/TnpB family protein -
  HXS57_RS01455 (NHP194003_02980) - 280614..281075 (+) 462 WP_073115515.1 hypothetical protein -
  HXS57_RS01460 (NHP194003_02990) - 281140..282993 (+) 1854 WP_176485806.1 type IV secretory system conjugative DNA transfer family protein -
  HXS57_RS01465 (NHP194003_03000) - 282995..291622 (+) 8628 WP_176485807.1 SNF2-related protein -
  HXS57_RS01470 (NHP194003_03010) - 291661..293718 (+) 2058 WP_104707183.1 type IA DNA topoisomerase -
  HXS57_RS01475 (NHP194003_03020) - 293734..295023 (+) 1290 WP_006565021.1 high persistence protein -
  HXS57_RS01480 (NHP194003_03030) - 295246..296022 (+) 777 WP_034375242.1 Fic family protein -
  HXS57_RS01485 (NHP194003_03040) - 296164..296718 (+) 555 WP_006564987.1 hypothetical protein -
  HXS57_RS01490 (NHP194003_03050) - 296730..296975 (+) 246 WP_006563801.1 ribbon-helix-helix domain-containing protein -
  HXS57_RS01495 (NHP194003_03060) - 297431..297646 (+) 216 WP_034375112.1 hypothetical protein -
  HXS57_RS01500 (NHP194003_03070) - 297680..298249 (+) 570 WP_050782144.1 ArdC-like ssDNA-binding domain-containing protein -
  HXS57_RS01505 (NHP194003_03080) - 298254..298796 (+) 543 WP_104705678.1 hypothetical protein -
  HXS57_RS01510 (NHP194003_03090) - 298809..299618 (+) 810 WP_231102946.1 Fic family protein -
  HXS57_RS01515 (NHP194003_03100) - 299691..301184 (+) 1494 WP_141556959.1 hypothetical protein -
  HXS57_RS01520 (NHP194003_03110) - 301184..303106 (+) 1923 WP_034375116.1 hypothetical protein -
  HXS57_RS01525 (NHP194003_03120) - 303096..304421 (+) 1326 WP_176485808.1 type IV secretion system protein -
  HXS57_RS01530 (NHP194003_03130) - 304445..305209 (-) 765 WP_064430254.1 Fic family protein -
  HXS57_RS01535 (NHP194003_03140) - 305287..305973 (+) 687 WP_143159247.1 hypothetical protein -
  HXS57_RS01540 (NHP194003_03150) - 305970..307280 (-) 1311 WP_232088062.1 hypothetical protein -
  HXS57_RS01545 (NHP194003_03160) - 308154..309221 (+) 1068 WP_034375873.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 8674.42 Da        Isoelectric Point: 10.3199

>NTDB_id=80765 HXS57_RS01395 WP_050780158.1 268518..268757(+) (comB2) [Helicobacter suis strain NHP19-4003]
MGVLQAGGLENLQNAIQSWLSSGSAKLILTIIFIGIGIFVWKNLDRWKEILLTVLGVVLGSLVFFGAPKLSAWLMQIFQ

Nucleotide


Download         Length: 240 bp        

>NTDB_id=80765 HXS57_RS01395 WP_050780158.1 268518..268757(+) (comB2) [Helicobacter suis strain NHP19-4003]
ATGGGAGTATTGCAAGCTGGGGGCTTGGAGAATCTGCAAAATGCCATCCAATCTTGGTTAAGTAGTGGCAGTGCCAAACT
AATTTTAACCATCATCTTCATAGGCATTGGTATCTTTGTGTGGAAAAACTTGGATCGGTGGAAAGAGATTTTGTTGACAG
TTCTAGGCGTGGTGTTAGGCTCTTTAGTCTTTTTTGGTGCGCCTAAGCTATCTGCTTGGTTGATGCAAATTTTTCAATAA

Domains

Predicted by InterproScan.

TrbC/VIRB2 pilin (TrbC)

(8-73)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB2 Helicobacter pylori 26695

60

94.937

0.57

Multiple sequence alignment