Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB2   Type   Machinery gene
Locus tag   HXS58_RS01985 Genome accession   NZ_AP023036
Coordinates   391174..391458 (-) Length   94 a.a.
NCBI ID   WP_176486225.1    Uniprot ID   -
Organism   Helicobacter suis strain NHP19-0020     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 360262..415482 391174..391458 within 0


Gene organization within MGE regions


Location: 360262..415482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HXS58_RS01805 (NHP190020_03770) - 360262..361329 (+) 1068 WP_001120380.1 tyrosine-type recombinase/integrase -
  HXS58_RS01810 (NHP190020_03790) - 361646..362453 (-) 808 Protein_371 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  HXS58_RS01815 (NHP190020_03800) - 362425..362676 (-) 252 WP_000006537.1 hypothetical protein -
  HXS58_RS01820 (NHP190020_03810) - 362808..363288 (-) 481 Protein_373 hypothetical protein -
  HXS58_RS01825 (NHP190020_03820) - 363538..364185 (+) 648 WP_104707240.1 hypothetical protein -
  HXS58_RS01830 (NHP190020_03830) - 364189..365430 (-) 1242 WP_176486118.1 hypothetical protein -
  HXS58_RS01835 (NHP190020_03840) - 365442..366680 (-) 1239 WP_176486119.1 type IV secretion system protein -
  HXS58_RS01840 (NHP190020_03850) - 366680..368113 (-) 1434 WP_176486120.1 hypothetical protein -
  HXS58_RS01845 (NHP190020_03860) - 368140..369998 (-) 1859 Protein_378 hypothetical protein -
  HXS58_RS09200 (NHP190020_03880) - 369998..371054 (-) 1057 Protein_379 ArdC-like ssDNA-binding domain-containing protein -
  HXS58_RS01865 (NHP190020_03900) - 371055..371219 (-) 165 WP_006564534.1 hypothetical protein -
  HXS58_RS01870 - 371852..371947 (+) 96 Protein_381 AAA family ATPase -
  HXS58_RS01880 - 372063..372432 (+) 370 Protein_382 hypothetical protein -
  HXS58_RS01885 (NHP190020_03940) - 372410..373014 (+) 605 Protein_383 hypothetical protein -
  HXS58_RS01890 (NHP190020_03960) - 372996..373151 (-) 156 WP_158650290.1 hypothetical protein -
  HXS58_RS01895 (NHP190020_03970) - 373121..373591 (-) 471 WP_000965788.1 hypothetical protein -
  HXS58_RS01900 (NHP190020_03990) - 373646..375709 (-) 2064 Protein_386 type IA DNA topoisomerase -
  HXS58_RS09205 (NHP190020_04000) - 375819..376040 (-) 222 WP_232088924.1 hypothetical protein -
  HXS58_RS01910 (NHP190020_04010) - 376204..376677 (-) 474 Protein_388 hypothetical protein -
  HXS58_RS01915 - 376697..378961 (-) 2265 Protein_389 type IV secretory system conjugative DNA transfer family protein -
  HXS58_RS01920 - 378958..379475 (-) 518 Protein_390 replication regulatory RepB family protein -
  HXS58_RS01925 (NHP190020_04080) - 379472..380412 (-) 941 Protein_391 ATPase, T2SS/T4P/T4SS family -
  HXS58_RS01930 (NHP190020_04090) - 380417..380672 (-) 256 Protein_392 hypothetical protein -
  HXS58_RS01935 (NHP190020_04100) - 380690..381682 (-) 993 WP_176486224.1 hypothetical protein -
  HXS58_RS01940 - 381679..383923 (-) 2245 Protein_394 collagen-like protein -
  HXS58_RS09665 - 383907..385106 (-) 1200 Protein_395 DNA type IV secretion system protein ComB10 -
  HXS58_RS01950 (NHP190020_04200) - 385103..386770 (-) 1668 WP_006565091.1 TrbG/VirB9 family P-type conjugative transfer protein -
  HXS58_RS01955 - 386767..387932 (-) 1166 Protein_397 type IV secretion system protein -
  HXS58_RS01960 - 387939..388058 (-) 120 Protein_398 type IV secretion system protein VirB7 -
  HXS58_RS09225 - 388077..390653 (-) 2577 Protein_399 VirB4 family type IV secretion/conjugal transfer ATPase -
  HXS58_RS01975 (NHP190020_04270) - 390653..390889 (-) 237 WP_034375660.1 hypothetical protein -
  HXS58_RS01980 (NHP190020_04280) comB3 390900..391163 (-) 264 WP_006564000.1 hypothetical protein Machinery gene
  HXS58_RS01985 comB2 391174..391458 (-) 285 WP_176486225.1 TrbC/VirB2 family protein Machinery gene
  HXS58_RS01990 - 391455..391935 (-) 481 Protein_403 hypothetical protein -
  HXS58_RS01995 (NHP190020_04300) - 392048..392830 (-) 783 Protein_404 integrase -
  HXS58_RS02000 (NHP190020_04310) - 392901..393182 (+) 282 WP_176486123.1 hypothetical protein -
  HXS58_RS09230 (NHP190020_04320) - 393227..393427 (+) 201 WP_176486531.1 hypothetical protein -
  HXS58_RS09710 - 393661..396684 (+) 3024 Protein_407 SNF2-related protein -
  HXS58_RS02010 (NHP190020_04400) - 397403..398308 (+) 906 WP_104683419.1 hypothetical protein -
  HXS58_RS02015 (NHP190020_04410) - 398347..400407 (+) 2061 WP_176486124.1 type IA DNA topoisomerase -
  HXS58_RS02020 (NHP190020_04420) - 400423..401712 (+) 1290 WP_006563803.1 high persistence protein -
  HXS58_RS02025 (NHP190020_04430) - 401935..402711 (+) 777 WP_034375242.1 Fic family protein -
  HXS58_RS02030 (NHP190020_04440) - 402853..403407 (+) 555 WP_006564987.1 hypothetical protein -
  HXS58_RS02035 (NHP190020_04450) - 403419..403664 (+) 246 WP_006563801.1 ribbon-helix-helix domain-containing protein -
  HXS58_RS02040 (NHP190020_04460) - 404120..404335 (+) 216 WP_034375112.1 hypothetical protein -
  HXS58_RS02045 (NHP190020_04470) - 404369..405487 (+) 1119 WP_050780120.1 ArdC-like ssDNA-binding domain-containing protein -
  HXS58_RS02050 (NHP190020_04480) - 405500..406309 (+) 810 WP_232087206.1 Fic family protein -
  HXS58_RS02055 (NHP190020_04490) - 406382..407875 (+) 1494 WP_141556959.1 hypothetical protein -
  HXS58_RS02060 (NHP190020_04500) - 407875..409797 (+) 1923 WP_034375116.1 hypothetical protein -
  HXS58_RS02065 (NHP190020_04510) - 409787..411109 (+) 1323 WP_176486092.1 type IV secretion system protein -
  HXS58_RS02070 (NHP190020_04520) - 411106..411525 (+) 420 WP_040499338.1 hypothetical protein -
  HXS58_RS02075 (NHP190020_04530) - 411605..412213 (+) 609 WP_141556997.1 hypothetical protein -
  HXS58_RS02080 (NHP190020_04540) - 412240..413541 (-) 1302 WP_232088034.1 hypothetical protein -
  HXS58_RS02085 (NHP190020_04550) - 414415..415482 (+) 1068 WP_034375873.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10708.01 Da        Isoelectric Point: 11.1589

>NTDB_id=80748 HXS58_RS01985 WP_176486225.1 391174..391458(-) (comB2) [Helicobacter suis strain NHP19-0020]
MKKLRHFRKLIAFLGFSPPLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTALAIAIGAAIF
FKAPALANWFMSIF

Nucleotide


Download         Length: 285 bp        

>NTDB_id=80748 HXS58_RS01985 WP_176486225.1 391174..391458(-) (comB2) [Helicobacter suis strain NHP19-0020]
ATGAAAAAATTAAGGCATTTTAGAAAGCTTATCGCCTTTTTAGGTTTTTCACCACCTTTATTACAAGCGGATATGACTAC
CTTTTTTAATAGCATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTCATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGCCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA

Domains


Predicted by InterproScan.

(4-90)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB2 Helicobacter pylori 26695

57.778

95.745

0.553


Multiple sequence alignment