Detailed information
Bioinformatically predicted
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | HXS58_RS01980 | Genome accession | NZ_AP023036 |
| Coordinates | 390900..391163 (-) | Length | 87 a.a. |
| NCBI ID | WP_006564000.1 | Uniprot ID | E7G366 |
| Organism | Helicobacter suis strain NHP19-0020 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 360262..415482 | 390900..391163 | within | 0 |
Gene organization within MGE regions
Location: 360262..415482
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HXS58_RS01805 (NHP190020_03770) | - | 360262..361329 (+) | 1068 | WP_001120380.1 | tyrosine-type recombinase/integrase | - |
| HXS58_RS01810 (NHP190020_03790) | - | 361646..362453 (-) | 808 | Protein_371 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| HXS58_RS01815 (NHP190020_03800) | - | 362425..362676 (-) | 252 | WP_000006537.1 | hypothetical protein | - |
| HXS58_RS01820 (NHP190020_03810) | - | 362808..363288 (-) | 481 | Protein_373 | hypothetical protein | - |
| HXS58_RS01825 (NHP190020_03820) | - | 363538..364185 (+) | 648 | WP_104707240.1 | hypothetical protein | - |
| HXS58_RS01830 (NHP190020_03830) | - | 364189..365430 (-) | 1242 | WP_176486118.1 | hypothetical protein | - |
| HXS58_RS01835 (NHP190020_03840) | - | 365442..366680 (-) | 1239 | WP_176486119.1 | type IV secretion system protein | - |
| HXS58_RS01840 (NHP190020_03850) | - | 366680..368113 (-) | 1434 | WP_176486120.1 | hypothetical protein | - |
| HXS58_RS01845 (NHP190020_03860) | - | 368140..369998 (-) | 1859 | Protein_378 | hypothetical protein | - |
| HXS58_RS09200 (NHP190020_03880) | - | 369998..371054 (-) | 1057 | Protein_379 | ArdC-like ssDNA-binding domain-containing protein | - |
| HXS58_RS01865 (NHP190020_03900) | - | 371055..371219 (-) | 165 | WP_006564534.1 | hypothetical protein | - |
| HXS58_RS01870 | - | 371852..371947 (+) | 96 | Protein_381 | AAA family ATPase | - |
| HXS58_RS01880 | - | 372063..372432 (+) | 370 | Protein_382 | hypothetical protein | - |
| HXS58_RS01885 (NHP190020_03940) | - | 372410..373014 (+) | 605 | Protein_383 | hypothetical protein | - |
| HXS58_RS01890 (NHP190020_03960) | - | 372996..373151 (-) | 156 | WP_158650290.1 | hypothetical protein | - |
| HXS58_RS01895 (NHP190020_03970) | - | 373121..373591 (-) | 471 | WP_000965788.1 | hypothetical protein | - |
| HXS58_RS01900 (NHP190020_03990) | - | 373646..375709 (-) | 2064 | Protein_386 | type IA DNA topoisomerase | - |
| HXS58_RS09205 (NHP190020_04000) | - | 375819..376040 (-) | 222 | WP_232088924.1 | hypothetical protein | - |
| HXS58_RS01910 (NHP190020_04010) | - | 376204..376677 (-) | 474 | Protein_388 | hypothetical protein | - |
| HXS58_RS01915 | - | 376697..378961 (-) | 2265 | Protein_389 | type IV secretory system conjugative DNA transfer family protein | - |
| HXS58_RS01920 | - | 378958..379475 (-) | 518 | Protein_390 | replication regulatory RepB family protein | - |
| HXS58_RS01925 (NHP190020_04080) | - | 379472..380412 (-) | 941 | Protein_391 | ATPase, T2SS/T4P/T4SS family | - |
| HXS58_RS01930 (NHP190020_04090) | - | 380417..380672 (-) | 256 | Protein_392 | hypothetical protein | - |
| HXS58_RS01935 (NHP190020_04100) | - | 380690..381682 (-) | 993 | WP_176486224.1 | hypothetical protein | - |
| HXS58_RS01940 | - | 381679..383923 (-) | 2245 | Protein_394 | collagen-like protein | - |
| HXS58_RS09665 | - | 383907..385106 (-) | 1200 | Protein_395 | DNA type IV secretion system protein ComB10 | - |
| HXS58_RS01950 (NHP190020_04200) | - | 385103..386770 (-) | 1668 | WP_006565091.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| HXS58_RS01955 | - | 386767..387932 (-) | 1166 | Protein_397 | type IV secretion system protein | - |
| HXS58_RS01960 | - | 387939..388058 (-) | 120 | Protein_398 | type IV secretion system protein VirB7 | - |
| HXS58_RS09225 | - | 388077..390653 (-) | 2577 | Protein_399 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| HXS58_RS01975 (NHP190020_04270) | - | 390653..390889 (-) | 237 | WP_034375660.1 | hypothetical protein | - |
| HXS58_RS01980 (NHP190020_04280) | comB3 | 390900..391163 (-) | 264 | WP_006564000.1 | hypothetical protein | Machinery gene |
| HXS58_RS01985 | comB2 | 391174..391458 (-) | 285 | WP_176486225.1 | TrbC/VirB2 family protein | Machinery gene |
| HXS58_RS01990 | - | 391455..391935 (-) | 481 | Protein_403 | hypothetical protein | - |
| HXS58_RS01995 (NHP190020_04300) | - | 392048..392830 (-) | 783 | Protein_404 | integrase | - |
| HXS58_RS02000 (NHP190020_04310) | - | 392901..393182 (+) | 282 | WP_176486123.1 | hypothetical protein | - |
| HXS58_RS09230 (NHP190020_04320) | - | 393227..393427 (+) | 201 | WP_176486531.1 | hypothetical protein | - |
| HXS58_RS09710 | - | 393661..396684 (+) | 3024 | Protein_407 | SNF2-related protein | - |
| HXS58_RS02010 (NHP190020_04400) | - | 397403..398308 (+) | 906 | WP_104683419.1 | hypothetical protein | - |
| HXS58_RS02015 (NHP190020_04410) | - | 398347..400407 (+) | 2061 | WP_176486124.1 | type IA DNA topoisomerase | - |
| HXS58_RS02020 (NHP190020_04420) | - | 400423..401712 (+) | 1290 | WP_006563803.1 | high persistence protein | - |
| HXS58_RS02025 (NHP190020_04430) | - | 401935..402711 (+) | 777 | WP_034375242.1 | Fic family protein | - |
| HXS58_RS02030 (NHP190020_04440) | - | 402853..403407 (+) | 555 | WP_006564987.1 | hypothetical protein | - |
| HXS58_RS02035 (NHP190020_04450) | - | 403419..403664 (+) | 246 | WP_006563801.1 | ribbon-helix-helix domain-containing protein | - |
| HXS58_RS02040 (NHP190020_04460) | - | 404120..404335 (+) | 216 | WP_034375112.1 | hypothetical protein | - |
| HXS58_RS02045 (NHP190020_04470) | - | 404369..405487 (+) | 1119 | WP_050780120.1 | ArdC-like ssDNA-binding domain-containing protein | - |
| HXS58_RS02050 (NHP190020_04480) | - | 405500..406309 (+) | 810 | WP_232087206.1 | Fic family protein | - |
| HXS58_RS02055 (NHP190020_04490) | - | 406382..407875 (+) | 1494 | WP_141556959.1 | hypothetical protein | - |
| HXS58_RS02060 (NHP190020_04500) | - | 407875..409797 (+) | 1923 | WP_034375116.1 | hypothetical protein | - |
| HXS58_RS02065 (NHP190020_04510) | - | 409787..411109 (+) | 1323 | WP_176486092.1 | type IV secretion system protein | - |
| HXS58_RS02070 (NHP190020_04520) | - | 411106..411525 (+) | 420 | WP_040499338.1 | hypothetical protein | - |
| HXS58_RS02075 (NHP190020_04530) | - | 411605..412213 (+) | 609 | WP_141556997.1 | hypothetical protein | - |
| HXS58_RS02080 (NHP190020_04540) | - | 412240..413541 (-) | 1302 | WP_232088034.1 | hypothetical protein | - |
| HXS58_RS02085 (NHP190020_04550) | - | 414415..415482 (+) | 1068 | WP_034375873.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9974.84 Da Isoelectric Point: 5.7206
>NTDB_id=80747 HXS58_RS01980 WP_006564000.1 390900..391163(-) (comB3) [Helicobacter suis strain NHP19-0020]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFVPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KSNSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFVPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KSNSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=80747 HXS58_RS01980 WP_006564000.1 390900..391163(-) (comB3) [Helicobacter suis strain NHP19-0020]
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGCTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAAAG
CTTTTTAATCGCAGGATTTGTTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAATCCAATTCATTTTATGCTTAA
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGCTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAAAG
CTTTTTAATCGCAGGATTTGTTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAATCCAATTCATTTTATGCTTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
58.621 |
100 |
0.586 |