Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | P5647_RS12905 | Genome accession | NZ_CP120622 |
| Coordinates | 2508273..2508683 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain DSM 1090 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2501376..2555129 | 2508273..2508683 | within | 0 |
Gene organization within MGE regions
Location: 2501376..2555129
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5647_RS12865 (P5647_12865) | yqeH | 2501376..2502476 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| P5647_RS12870 (P5647_12870) | yqeG | 2502480..2502998 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| P5647_RS12875 (P5647_12875) | - | 2503360..2503500 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| P5647_RS12880 (P5647_12880) | yqeF | 2503806..2504537 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| P5647_RS12885 (P5647_12885) | cwlH | 2504789..2505541 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| P5647_RS12890 (P5647_12890) | yqeD | 2505728..2506354 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| P5647_RS12895 (P5647_12895) | gnd | 2506373..2507266 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| P5647_RS12900 (P5647_12900) | yqeB | 2507518..2508240 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| P5647_RS12905 (P5647_12905) | nucA/comI | 2508273..2508683 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| P5647_RS12910 (P5647_12910) | - | 2508879..2509226 (+) | 348 | Protein_2502 | sigma-70 family RNA polymerase sigma factor | - |
| P5647_RS12915 (P5647_12915) | spoIVCA | 2509257..2510717 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| P5647_RS12920 (P5647_12920) | - | 2510675..2510853 (-) | 179 | Protein_2504 | hypothetical protein | - |
| P5647_RS12925 (P5647_12925) | arsC | 2511208..2511627 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| P5647_RS12930 (P5647_12930) | acr3 | 2511639..2512679 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| P5647_RS12935 (P5647_12935) | arsK | 2512702..2513142 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| P5647_RS12940 (P5647_12940) | arsR | 2513203..2513520 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| P5647_RS12945 (P5647_12945) | yqcI | 2513892..2514656 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| P5647_RS12950 (P5647_12950) | rapE | 2515099..2516226 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| P5647_RS12955 (P5647_12955) | phrE | 2516216..2516350 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| P5647_RS12960 (P5647_12960) | - | 2516460..2516618 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| P5647_RS12965 (P5647_12965) | yqcG | 2516988..2518583 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| P5647_RS12970 (P5647_12970) | yqcF | 2518598..2519176 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| P5647_RS12975 (P5647_12975) | - | 2519294..2519440 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| P5647_RS12980 (P5647_12980) | - | 2519437..2519799 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| P5647_RS12985 (P5647_12985) | - | 2519815..2520294 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| P5647_RS12990 (P5647_12990) | cwlA | 2520459..2521277 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| P5647_RS12995 (P5647_12995) | skhD | 2521322..2521744 (-) | 423 | WP_003246208.1 | holin family protein | - |
| P5647_RS13000 (P5647_13000) | xepAK | 2521789..2522682 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| P5647_RS13005 (P5647_13005) | yqcE | 2522770..2522934 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| P5647_RS13010 (P5647_13010) | yqcD | 2522931..2523266 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| P5647_RS13015 (P5647_13015) | yqcC | 2523276..2524376 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| P5647_RS13020 (P5647_13020) | - | 2524379..2524651 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| P5647_RS13025 (P5647_13025) | yqcA | 2524648..2525226 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| P5647_RS13030 (P5647_13030) | yqbT | 2525210..2526256 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| P5647_RS13035 (P5647_13035) | yqbS | 2526249..2526674 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| P5647_RS13040 (P5647_13040) | yqbR | 2526687..2526950 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| P5647_RS13045 (P5647_13045) | yqbQ | 2526947..2527927 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| P5647_RS13050 (P5647_13050) | yqbP | 2527940..2528599 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| P5647_RS13055 (P5647_13055) | yqbO | 2528592..2533349 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| P5647_RS13060 (P5647_13060) | - | 2533352..2533489 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| P5647_RS13065 (P5647_13065) | - | 2533531..2533980 (-) | 450 | WP_003229933.1 | phage portal protein | - |
| P5647_RS13070 (P5647_13070) | txpA | 2534126..2534305 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| P5647_RS13075 (P5647_13075) | bsrH | 2534685..2534774 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| P5647_RS13080 (P5647_13080) | yqbM | 2535028..2535471 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| P5647_RS13085 (P5647_13085) | yqbK | 2535474..2536874 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| P5647_RS13090 (P5647_13090) | - | 2536875..2537066 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| P5647_RS13095 (P5647_13095) | yqbJ | 2537063..2537500 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| P5647_RS13100 (P5647_13100) | yqbI | 2537513..2538016 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| P5647_RS13105 (P5647_13105) | yqbH | 2538013..2538375 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| P5647_RS13110 (P5647_13110) | gkpG | 2538372..2538767 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| P5647_RS13115 (P5647_13115) | yqbF | 2538771..2539082 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| P5647_RS13120 (P5647_13120) | skdG | 2539093..2540028 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| P5647_RS13125 (P5647_13125) | yqbD | 2540047..2541015 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| P5647_RS13130 (P5647_13130) | - | 2541048..2541701 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| P5647_RS13135 (P5647_13135) | yqbB | 2541742..2542659 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| P5647_RS13140 (P5647_13140) | yqbA | 2542656..2544188 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| P5647_RS13145 (P5647_13145) | stmB | 2544192..2545487 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| P5647_RS13150 (P5647_13150) | terS | 2545480..2546199 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| P5647_RS13155 (P5647_13155) | - | 2546267..2546731 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| P5647_RS13160 (P5647_13160) | yqaQ | 2546875..2547330 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| P5647_RS13165 (P5647_13165) | - | 2547528..2548457 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| P5647_RS13170 (P5647_13170) | yqaO | 2548531..2548737 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| P5647_RS13175 (P5647_13175) | yqaN | 2548819..2549247 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P5647_RS13180 (P5647_13180) | - | 2549343..2549492 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| P5647_RS13185 (P5647_13185) | sknM | 2549483..2550424 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| P5647_RS13190 (P5647_13190) | yqaL | 2550306..2550983 (-) | 678 | WP_116362964.1 | DnaD domain protein | - |
| P5647_RS13195 (P5647_13195) | recT | 2551059..2551913 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| P5647_RS13200 (P5647_13200) | yqaJ | 2551916..2552875 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| P5647_RS13205 (P5647_13205) | - | 2552981..2553175 (-) | 195 | WP_003229905.1 | hypothetical protein | - |
| P5647_RS13210 (P5647_13210) | - | 2553135..2553308 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| P5647_RS13215 (P5647_13215) | sknH | 2553305..2553562 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| P5647_RS13220 (P5647_13220) | yqaG | 2553559..2554128 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| P5647_RS13225 (P5647_13225) | - | 2554202..2554342 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| P5647_RS13230 (P5647_13230) | yqaF | 2554372..2554602 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| P5647_RS13235 (P5647_13235) | sknR | 2554779..2555129 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=807146 P5647_RS12905 WP_009967785.1 2508273..2508683(-) (nucA/comI) [Bacillus subtilis strain DSM 1090]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=807146 P5647_RS12905 WP_009967785.1 2508273..2508683(-) (nucA/comI) [Bacillus subtilis strain DSM 1090]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |