Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P5657_RS12010 Genome accession   NZ_CP120621
Coordinates   2293059..2293232 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain DSM 13019     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2288059..2298232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5657_RS11965 (P5657_11965) comGE 2288409..2288756 (+) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  P5657_RS11970 (P5657_11970) comGF 2288782..2289165 (+) 384 WP_085186490.1 ComG operon protein ComGF Machinery gene
  P5657_RS11975 (P5657_11975) comGG 2289166..2289540 (+) 375 WP_021480019.1 ComG operon protein ComGG Machinery gene
  P5657_RS11980 (P5657_11980) spoIITA 2289612..2289791 (+) 180 WP_003230176.1 YqzE family protein -
  P5657_RS11985 (P5657_11985) yqzG 2289833..2290159 (-) 327 WP_085186489.1 YqzG/YhdC family protein -
  P5657_RS11990 (P5657_11990) tapA 2290430..2291191 (+) 762 WP_277709892.1 amyloid fiber anchoring/assembly protein TapA -
  P5657_RS11995 (P5657_11995) sipW 2291175..2291747 (+) 573 WP_134991456.1 signal peptidase I SipW -
  P5657_RS12000 (P5657_12000) tasA 2291812..2292597 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  P5657_RS12005 (P5657_12005) sinR 2292690..2293025 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5657_RS12010 (P5657_12010) sinI 2293059..2293232 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5657_RS12015 (P5657_12015) yqhG 2293415..2294209 (-) 795 WP_003230200.1 YqhG family protein -
  P5657_RS12020 (P5657_12020) hepAA 2294230..2295903 (-) 1674 WP_134991296.1 SNF2-related protein -
  P5657_RS12025 (P5657_12025) gcvT 2296344..2297432 (+) 1089 WP_042976496.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=807063 P5657_RS12010 WP_003230187.1 2293059..2293232(-) (sinI) [Bacillus subtilis strain DSM 13019]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=807063 P5657_RS12010 WP_003230187.1 2293059..2293232(-) (sinI) [Bacillus subtilis strain DSM 13019]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1