Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P5657_RS12010 | Genome accession | NZ_CP120621 |
| Coordinates | 2293059..2293232 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis strain DSM 13019 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2288059..2298232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5657_RS11965 (P5657_11965) | comGE | 2288409..2288756 (+) | 348 | WP_046160583.1 | ComG operon protein 5 | Machinery gene |
| P5657_RS11970 (P5657_11970) | comGF | 2288782..2289165 (+) | 384 | WP_085186490.1 | ComG operon protein ComGF | Machinery gene |
| P5657_RS11975 (P5657_11975) | comGG | 2289166..2289540 (+) | 375 | WP_021480019.1 | ComG operon protein ComGG | Machinery gene |
| P5657_RS11980 (P5657_11980) | spoIITA | 2289612..2289791 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| P5657_RS11985 (P5657_11985) | yqzG | 2289833..2290159 (-) | 327 | WP_085186489.1 | YqzG/YhdC family protein | - |
| P5657_RS11990 (P5657_11990) | tapA | 2290430..2291191 (+) | 762 | WP_277709892.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P5657_RS11995 (P5657_11995) | sipW | 2291175..2291747 (+) | 573 | WP_134991456.1 | signal peptidase I SipW | - |
| P5657_RS12000 (P5657_12000) | tasA | 2291812..2292597 (+) | 786 | WP_014477324.1 | biofilm matrix protein TasA | - |
| P5657_RS12005 (P5657_12005) | sinR | 2292690..2293025 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| P5657_RS12010 (P5657_12010) | sinI | 2293059..2293232 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| P5657_RS12015 (P5657_12015) | yqhG | 2293415..2294209 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| P5657_RS12020 (P5657_12020) | hepAA | 2294230..2295903 (-) | 1674 | WP_134991296.1 | SNF2-related protein | - |
| P5657_RS12025 (P5657_12025) | gcvT | 2296344..2297432 (+) | 1089 | WP_042976496.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=807063 P5657_RS12010 WP_003230187.1 2293059..2293232(-) (sinI) [Bacillus subtilis strain DSM 13019]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=807063 P5657_RS12010 WP_003230187.1 2293059..2293232(-) (sinI) [Bacillus subtilis strain DSM 13019]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |