Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   P5653_RS17315 Genome accession   NZ_CP120610
Coordinates   3392831..3392971 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain DSM 28591     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3387831..3397971
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5653_RS17290 (P5653_17290) - 3388125..3388514 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  P5653_RS17295 (P5653_17295) comA 3388531..3389169 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  P5653_RS17300 (P5653_17300) comP 3389256..3391571 (-) 2316 WP_020452789.1 ATP-binding protein Regulator
  P5653_RS17305 (P5653_17305) comX 3391592..3391762 (-) 171 WP_020452790.1 competence pheromone ComX -
  P5653_RS17310 (P5653_17310) - 3391734..3392645 (-) 912 WP_035337591.1 polyprenyl synthetase family protein -
  P5653_RS17315 (P5653_17315) degQ 3392831..3392971 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  P5653_RS17320 (P5653_17320) - 3393457..3393804 (+) 348 WP_223254849.1 hypothetical protein -
  P5653_RS17325 (P5653_17325) - 3393847..3395067 (-) 1221 WP_035337594.1 HDOD domain-containing protein -
  P5653_RS17330 (P5653_17330) - 3395245..3396714 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  P5653_RS17335 (P5653_17335) - 3396732..3397283 (-) 552 WP_020452795.1 isochorismatase family cysteine hydrolase -
  P5653_RS17340 (P5653_17340) - 3397469..3397870 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=806850 P5653_RS17315 WP_003184860.1 3392831..3392971(-) (degQ) [Bacillus paralicheniformis strain DSM 28591]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=806850 P5653_RS17315 WP_003184860.1 3392831..3392971(-) (degQ) [Bacillus paralicheniformis strain DSM 28591]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652