Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   P5637_RS09400 Genome accession   NZ_CP120601
Coordinates   1829136..1829312 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain PRO109     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1824136..1834312
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5637_RS09385 (P5637_09385) gcvT 1824777..1825871 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  P5637_RS09390 (P5637_09390) - 1826466..1828145 (+) 1680 WP_020452163.1 SNF2-related protein -
  P5637_RS09395 (P5637_09395) - 1828152..1828946 (+) 795 WP_020452164.1 YqhG family protein -
  P5637_RS09400 (P5637_09400) sinI 1829136..1829312 (+) 177 WP_020452165.1 anti-repressor SinI family protein Regulator
  P5637_RS09405 (P5637_09405) sinR 1829346..1829681 (+) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  P5637_RS09410 (P5637_09410) - 1829786..1830580 (-) 795 WP_020452167.1 TasA family protein -
  P5637_RS09415 (P5637_09415) - 1830653..1831237 (-) 585 WP_023855186.1 signal peptidase I -
  P5637_RS09420 (P5637_09420) tapA 1831234..1831962 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  P5637_RS09425 (P5637_09425) - 1832239..1832559 (+) 321 WP_103749520.1 YqzG/YhdC family protein -
  P5637_RS09430 (P5637_09430) - 1832589..1832771 (-) 183 WP_020452171.1 YqzE family protein -
  P5637_RS09435 (P5637_09435) comGG 1832860..1833225 (-) 366 WP_026579313.1 competence type IV pilus minor pilin ComGG -
  P5637_RS09440 (P5637_09440) comGF 1833237..1833725 (-) 489 WP_223254778.1 competence type IV pilus minor pilin ComGF -
  P5637_RS09445 (P5637_09445) comGE 1833634..1833981 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=806643 P5637_RS09400 WP_020452165.1 1829136..1829312(+) (sinI) [Bacillus paralicheniformis strain PRO109]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=806643 P5637_RS09400 WP_020452165.1 1829136..1829312(+) (sinI) [Bacillus paralicheniformis strain PRO109]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5