Detailed information    

insolico Bioinformatically predicted

Overview

Name   rapC   Type   Regulator
Locus tag   P3L57_RS09510 Genome accession   NZ_CP120511
Coordinates   1937359..1938495 (-) Length   378 a.a.
NCBI ID   WP_069486583.1    Uniprot ID   -
Organism   Bacillus sp. B28     
Function   inhibit the DNA-binding function of ComA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1917237..1970302 1937359..1938495 within 0


Gene organization within MGE regions


Location: 1917237..1970302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3L57_RS09390 (P3L57_09390) - 1917237..1917392 (+) 156 Protein_1793 hypothetical protein -
  P3L57_RS09395 (P3L57_09395) - 1917391..1918645 (+) 1255 Protein_1794 hypothetical protein -
  P3L57_RS09400 (P3L57_09400) - 1918654..1919151 (+) 498 WP_069486568.1 SMI1/KNR4 family protein -
  P3L57_RS09405 (P3L57_09405) - 1919215..1919793 (+) 579 WP_069486569.1 SMI1/KNR4 family protein -
  P3L57_RS09410 (P3L57_09410) - 1920305..1920856 (+) 552 WP_069486570.1 hypothetical protein -
  P3L57_RS09415 (P3L57_09415) - 1920876..1921124 (+) 249 WP_232460785.1 DUF2651 family protein -
  P3L57_RS09420 (P3L57_09420) - 1921347..1921679 (+) 333 WP_069486572.1 YolD-like family protein -
  P3L57_RS09425 (P3L57_09425) - 1921672..1922777 (+) 1106 Protein_1800 Y-family DNA polymerase -
  P3L57_RS09430 (P3L57_09430) - 1922849..1924375 (-) 1527 WP_069486573.1 L-lactate permease -
  P3L57_RS09435 (P3L57_09435) - 1924439..1926376 (-) 1938 WP_069486574.1 putative PEP-binding protein -
  P3L57_RS09440 (P3L57_09440) ilvE 1926384..1927289 (-) 906 WP_069486575.1 branched-chain-amino-acid transaminase -
  P3L57_RS09445 (P3L57_09445) - 1927574..1928128 (+) 555 WP_069486576.1 XRE family transcriptional regulator -
  P3L57_RS09450 (P3L57_09450) - 1928358..1928609 (-) 252 WP_069486577.1 phage holin -
  P3L57_RS09455 (P3L57_09455) - 1928630..1929022 (-) 393 WP_069486578.1 hypothetical protein -
  P3L57_RS09460 (P3L57_09460) - 1929138..1930241 (-) 1104 WP_069486579.1 N-acetylmuramoyl-L-alanine amidase family protein -
  P3L57_RS09465 (P3L57_09465) - 1931169..1931738 (-) 570 WP_254665039.1 hypothetical protein -
  P3L57_RS09470 (P3L57_09470) - 1931719..1931895 (-) 177 WP_227492934.1 hypothetical protein -
  P3L57_RS09475 (P3L57_09475) - 1932274..1932912 (+) 639 Protein_1810 T7SS effector LXG polymorphic toxin -
  P3L57_RS09480 (P3L57_09480) - 1932920..1933069 (+) 150 Protein_1811 GNAT family protein -
  P3L57_RS20640 - 1933344..1933640 (+) 297 Protein_1812 hypothetical protein -
  P3L57_RS09485 (P3L57_09485) - 1934092..1935381 (+) 1290 WP_069486580.1 Na+/H+ antiporter NhaC family protein -
  P3L57_RS09490 (P3L57_09490) - 1935555..1935949 (+) 395 Protein_1814 UV damage repair protein UvrX -
  P3L57_RS09495 (P3L57_09495) bglS 1936123..1936854 (-) 732 WP_069486581.1 beta-glucanase -
  P3L57_RS09500 (P3L57_09500) - 1936970..1937148 (+) 179 Protein_1816 UV damage repair protein UvrX -
  P3L57_RS09505 (P3L57_09505) - 1937190..1937369 (-) 180 WP_069486582.1 aspartate phosphatase -
  P3L57_RS09510 (P3L57_09510) rapC 1937359..1938495 (-) 1137 WP_069486583.1 RapH N-terminal domain-containing protein Regulator
  P3L57_RS09515 (P3L57_09515) - 1938601..1938741 (-) 141 WP_083244467.1 phage holin -
  P3L57_RS09520 (P3L57_09520) - 1939595..1939876 (-) 282 WP_024121543.1 LCI fold-containing protein -
  P3L57_RS09525 (P3L57_09525) - 1940439..1940639 (+) 201 WP_059291765.1 hypothetical protein -
  P3L57_RS09530 (P3L57_09530) - 1940779..1941054 (-) 276 WP_024121546.1 LCI fold-containing protein -
  P3L57_RS09535 (P3L57_09535) - 1941405..1941581 (+) 177 Protein_1823 hypothetical protein -
  P3L57_RS09540 (P3L57_09540) - 1941614..1941988 (-) 375 WP_069486584.1 YoqO family protein -
  P3L57_RS20645 - 1942370..1942495 (-) 126 WP_320109126.1 hypothetical protein -
  P3L57_RS09545 (P3L57_09545) - 1942654..1943028 (+) 375 Protein_1826 hypothetical protein -
  P3L57_RS09550 (P3L57_09550) - 1943131..1943726 (-) 596 Protein_1827 ATP-dependent DNA ligase -
  P3L57_RS09555 (P3L57_09555) - 1944047..1944688 (+) 642 WP_059293828.1 glycoside hydrolase family 11 protein -
  P3L57_RS09560 (P3L57_09560) - 1945158..1945340 (+) 183 WP_325099870.1 SUMF1/EgtB/PvdO family nonheme iron enzyme -
  P3L57_RS09565 (P3L57_09565) - 1945518..1945826 (+) 309 WP_254665040.1 SUMF1/EgtB/PvdO family nonheme iron enzyme -
  P3L57_RS09570 (P3L57_09570) - 1946146..1946412 (-) 267 WP_083244468.1 hypothetical protein -
  P3L57_RS09575 (P3L57_09575) - 1946485..1946700 (+) 216 Protein_1832 hypothetical protein -
  P3L57_RS09580 (P3L57_09580) - 1946701..1947288 (+) 588 Protein_1833 CPBP family intramembrane glutamic endopeptidase -
  P3L57_RS09585 (P3L57_09585) - 1947714..1948097 (+) 384 WP_059335703.1 UPF0715 family protein -
  P3L57_RS09590 (P3L57_09590) alr 1948299..1949480 (-) 1182 WP_059335702.1 alanine racemase -
  P3L57_RS09595 (P3L57_09595) - 1950024..1950935 (+) 912 WP_069486585.1 VanW family protein -
  P3L57_RS09600 (P3L57_09600) - 1951237..1952028 (-) 792 WP_044155762.1 DUF817 domain-containing protein -
  P3L57_RS09605 (P3L57_09605) - 1952162..1952383 (-) 222 WP_069486586.1 helix-turn-helix transcriptional regulator -
  P3L57_RS09610 (P3L57_09610) - 1952394..1952876 (-) 483 WP_044155761.1 DUF2975 domain-containing protein -
  P3L57_RS09615 (P3L57_09615) - 1953191..1953865 (-) 675 WP_069486587.1 SOS response-associated peptidase -
  P3L57_RS09620 (P3L57_09620) - 1954427..1956847 (-) 2421 WP_069486588.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  P3L57_RS09625 (P3L57_09625) - 1957375..1957680 (+) 306 WP_059291753.1 hypothetical protein -
  P3L57_RS09630 (P3L57_09630) - 1957804..1958526 (-) 723 WP_139127433.1 YrpD family protein -
  P3L57_RS09635 (P3L57_09635) - 1958879..1959082 (-) 204 WP_024121562.1 spore coat protein CotC -
  P3L57_RS09640 (P3L57_09640) - 1959275..1959463 (-) 189 WP_044155756.1 twin-arginine translocase TatA/TatE family subunit -
  P3L57_RS09645 (P3L57_09645) - 1959724..1960122 (+) 399 WP_069486590.1 hypothetical protein -
  P3L57_RS09650 (P3L57_09650) - 1960214..1960648 (-) 435 WP_059335697.1 SRPBCC domain-containing protein -
  P3L57_RS09655 (P3L57_09655) - 1961014..1961202 (+) 189 WP_059335696.1 hypothetical protein -
  P3L57_RS09660 (P3L57_09660) - 1961272..1962072 (+) 801 WP_059335695.1 hypothetical protein -
  P3L57_RS09665 (P3L57_09665) - 1962077..1962697 (+) 621 WP_069486631.1 DUF4166 domain-containing protein -
  P3L57_RS09670 (P3L57_09670) - 1962691..1964322 (+) 1632 WP_069486591.1 YndJ family protein -
  P3L57_RS09675 (P3L57_09675) - 1964433..1964744 (+) 312 WP_044155745.1 hypothetical protein -
  P3L57_RS09680 (P3L57_09680) - 1964984..1965742 (+) 759 WP_059352970.1 poly-gamma-glutamate hydrolase family protein -
  P3L57_RS09685 (P3L57_09685) - 1965765..1966220 (-) 456 WP_069486592.1 YndM family protein -
  P3L57_RS09690 (P3L57_09690) - 1966229..1966528 (-) 300 WP_059335692.1 spore coat protein -
  P3L57_RS09695 (P3L57_09695) - 1966525..1966728 (-) 204 WP_024121571.1 DUF892 family protein -
  P3L57_RS09700 (P3L57_09700) fosM 1966925..1967347 (+) 423 WP_059291743.1 FosM family fosfomycin resistance protein -
  P3L57_RS09705 (P3L57_09705) - 1967428..1967856 (+) 429 WP_083244471.1 hypothetical protein -
  P3L57_RS09710 (P3L57_09710) lexA 1968249..1968866 (-) 618 WP_010334405.1 transcriptional repressor LexA -
  P3L57_RS09715 (P3L57_09715) yneA 1969023..1969334 (+) 312 WP_059291742.1 cell division suppressor protein YneA -
  P3L57_RS09720 (P3L57_09720) - 1969352..1970005 (+) 654 WP_024121575.1 recombinase family protein -
  P3L57_RS09725 (P3L57_09725) - 1970069..1970302 (+) 234 WP_024121576.1 DUF896 domain-containing protein -

Sequence

Protein


Download         Length: 378 a.a.        Molecular weight: 44846.14 Da        Isoelectric Point: 4.7798

>NTDB_id=805923 P3L57_RS09510 WP_069486583.1 1937359..1938495(-) (rapC) [Bacillus sp. B28]
MEQMISSSKVGVKINEWYKYIRLFSVPDSEILKAEVEEEIKHMKEDQDLLLYYSLMCFRHQLMLDYLEPKTMNEERLKIS
DLLEKIESNQTDLKGILEYYFNFFRGMYEFEQYEYLNAISFYKQSEKKLSLVADEIERAEFHYKVAEIYYHMKQTHMSMH
HIVQAIETYKAHETYTVRVIQCSFVIGLNYLDMEYPEKAIPHFKEALDKAREIDMPRLIGSSLYNLGLCSFAEEAYEKAA
EYFKEGILVYQNNGYEHSNRLLDILLMLSKTTFKMRNQSEAISWCAHGLSLSKNLNDEIMAKMFEFINALYVDDDNEELN
SILNYLESKSMLSDVEDLASEAAKYYNEKEDHKVANVFYEKVLYARKQIQRGDCLYET

Nucleotide


Download         Length: 1137 bp        

>NTDB_id=805923 P3L57_RS09510 WP_069486583.1 1937359..1938495(-) (rapC) [Bacillus sp. B28]
TTGGAGCAAATGATCTCTTCTTCTAAAGTTGGAGTGAAAATAAATGAGTGGTATAAATACATAAGATTGTTTAGTGTCCC
AGATTCGGAAATATTGAAAGCTGAGGTCGAGGAAGAAATAAAGCATATGAAAGAAGATCAAGATTTATTGTTGTACTATT
CTCTCATGTGTTTTCGCCATCAGCTGATGCTGGATTACCTTGAACCCAAAACAATGAACGAAGAACGCCTCAAAATTTCA
GACTTATTAGAAAAGATCGAAAGTAACCAAACTGATTTGAAAGGAATTCTTGAATATTATTTTAACTTTTTCCGGGGTAT
GTATGAATTTGAACAGTACGAATATCTTAATGCCATAAGCTTCTATAAGCAATCCGAGAAAAAGCTATCACTTGTCGCAG
ATGAGATAGAACGAGCAGAATTCCACTACAAAGTTGCAGAGATTTATTATCATATGAAGCAGACACACATGTCGATGCAT
CATATAGTTCAAGCAATAGAGACTTATAAAGCACATGAAACATATACTGTAAGGGTTATTCAATGTTCGTTTGTTATTGG
ACTAAACTATTTAGATATGGAATATCCTGAAAAAGCGATCCCTCATTTTAAAGAAGCTCTAGACAAAGCAAGAGAAATCG
ACATGCCACGTTTAATCGGTTCGTCCCTATATAATCTTGGCTTATGTTCATTTGCTGAGGAAGCTTATGAAAAGGCAGCT
GAGTACTTTAAAGAAGGTATACTAGTATACCAAAACAACGGGTATGAGCATTCAAATCGTTTATTAGATATCTTGTTAAT
GTTATCAAAAACCACATTTAAAATGAGGAATCAATCAGAAGCAATTTCTTGGTGTGCGCATGGTCTGTCTTTGTCCAAGA
ATTTAAATGATGAAATTATGGCTAAAATGTTTGAATTCATTAATGCCTTATATGTTGATGACGACAATGAAGAATTAAAT
TCGATTCTAAATTATTTAGAATCGAAATCAATGCTTTCAGACGTGGAGGATTTAGCCTCAGAAGCAGCGAAGTATTATAA
TGAAAAAGAAGACCATAAAGTAGCTAATGTTTTTTATGAGAAAGTGCTTTATGCCCGTAAACAAATTCAGAGAGGGGATT
GTCTTTATGAAACTTAA

Domains

Predicted by InterproScan.

response regulator aspartate phosphatase H, N terminal (RapH_N)

(5-65)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rapC Bacillus subtilis subsp. subtilis str. 168

48.541

99.735

0.484
  rapF Bacillus subtilis subsp. subtilis str. 168

45.526

100

0.458