Detailed information NTG0804354

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3T97_RS07010
• Genome accession: NZ_CP120185
• Coordinates: 1405196..1405513 (+)
• Length: 105 a.a.
• NCBI ID: WP_037588275.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain Dog013
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1400196..1410513

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3T97_RS06970 (P3T97_06970)	-	1400341..1400532 (+)	192	WP_078099923.1	YqgQ family protein	-
P3T97_RS06975 (P3T97_06975)	-	1400529..1401500 (+)	972	WP_126477511.1	ROK family glucokinase	-
P3T97_RS06980 (P3T97_06980)	-	1401500..1401814 (+)	315	WP_048539720.1	MTH1187 family thiamine-binding protein	-
P3T97_RS06985 (P3T97_06985)	-	1401844..1402083 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
P3T97_RS06990 (P3T97_06990)	-	1402181..1402813 (+)	633	WP_126477510.1	MBL fold metallo-hydrolase	-
P3T97_RS06995 (P3T97_06995)	-	1402846..1403094 (-)	249	WP_025904960.1	DUF2626 family protein	-
P3T97_RS07000 (P3T97_07000)	comGA	1403248..1404150 (+)	903	WP_191835610.1	competence type IV pilus ATPase ComGA	Machinery gene
P3T97_RS07005 (P3T97_07005)	comGB	1404140..1405180 (+)	1041	WP_126477508.1	competence type IV pilus assembly protein ComGB	-
P3T97_RS07010 (P3T97_07010)	comGC	1405196..1405513 (+)	318	WP_037588275.1	competence type IV pilus major pilin ComGC	Machinery gene
P3T97_RS07015 (P3T97_07015)	-	1405542..1405940 (+)	399	WP_239705348.1	prepilin-type cleavage/methylation domain-containing protein	-
P3T97_RS07020 (P3T97_07020)	comGE	1405924..1406205 (+)	282	WP_126477507.1	competence type IV pilus minor pilin ComGE	-
P3T97_RS07025 (P3T97_07025)	comGF	1406180..1406614 (+)	435	WP_191835609.1	competence type IV pilus minor pilin ComGF	-
P3T97_RS07030 (P3T97_07030)	-	1406849..1407337 (+)	489	WP_037588260.1	shikimate kinase	-
P3T97_RS07035 (P3T97_07035)	gcvT	1407530..1408618 (+)	1089	WP_323714513.1	glycine cleavage system aminomethyltransferase GcvT	-
P3T97_RS07040 (P3T97_07040)	gcvPA	1408630..1409973 (+)	1344	WP_191835608.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11591.65 Da
• Isoelectric Point: 8.5043

>NTDB_id=804354 P3T97_RS07010 WP_037588275.1 1405196..1405513(+) (comGC) [Mammaliicoccus sciuri strain Dog013]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVSDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=804354 P3T97_RS07010 WP_037588275.1 1405196..1405513(+) (comGC) [Mammaliicoccus sciuri strain Dog013]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGATTTACATTGGTTGAGATGCTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATAAGTAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCTCAAGTGAAAA
TGGTTGCTGGACAAGTAGAAGCTTATACATTGAAACACGACGCTAAACCAAATTCTATAAATGATTTAGTAAGTGATGGT
TATATTAATCAAAAGCAACTGACATGTAAATCAGGTGAGACAATTACACTTGAAAATGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	49.425	82.857	0.41
comYC	Streptococcus mutans UA140	49.425	82.857	0.41
comYC	Streptococcus gordonii str. Challis substr. CH1	48.837	81.905	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362