Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PX690_RS06740 Genome accession   NZ_CP119675
Coordinates   1221960..1222100 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 160     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1216960..1227100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PX690_RS06715 (PX690_06715) - 1217300..1217683 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  PX690_RS06720 (PX690_06720) comA 1217705..1218349 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  PX690_RS06725 (PX690_06725) comP 1218430..1220721 (-) 2292 WP_276123525.1 histidine kinase Regulator
  PX690_RS06730 (PX690_06730) comX 1220733..1220897 (-) 165 WP_007613432.1 competence pheromone ComX -
  PX690_RS06735 (PX690_06735) - 1220897..1221775 (-) 879 WP_024085740.1 polyprenyl synthetase family protein -
  PX690_RS06740 (PX690_06740) degQ 1221960..1222100 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PX690_RS06745 (PX690_06745) - 1222566..1222907 (+) 342 WP_276123526.1 hypothetical protein -
  PX690_RS06750 (PX690_06750) - 1222914..1224134 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  PX690_RS06755 (PX690_06755) - 1224264..1225730 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  PX690_RS06760 (PX690_06760) - 1225748..1226299 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  PX690_RS06765 (PX690_06765) - 1226396..1226794 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=800178 PX690_RS06740 WP_003152043.1 1221960..1222100(-) (degQ) [Bacillus velezensis strain 160]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=800178 PX690_RS06740 WP_003152043.1 1221960..1222100(-) (degQ) [Bacillus velezensis strain 160]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891