Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | P1K87_RS14805 | Genome accession | NZ_CP119596 |
| Coordinates | 3010620..3010760 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain MG-2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3005620..3015760
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1K87_RS14780 (P1K87_14780) | - | 3005966..3006349 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| P1K87_RS14785 (P1K87_14785) | comA | 3006371..3007015 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| P1K87_RS14790 (P1K87_14790) | comP | 3007096..3009396 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| P1K87_RS14795 (P1K87_14795) | comX | 3009410..3009583 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| P1K87_RS14800 (P1K87_14800) | - | 3009552..3010412 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| P1K87_RS14805 (P1K87_14805) | degQ | 3010620..3010760 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| P1K87_RS14810 (P1K87_14810) | - | 3011226..3011567 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| P1K87_RS14815 (P1K87_14815) | - | 3011574..3012797 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| P1K87_RS14820 (P1K87_14820) | - | 3012927..3014393 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| P1K87_RS14825 (P1K87_14825) | - | 3014411..3014962 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| P1K87_RS14830 (P1K87_14830) | - | 3015059..3015457 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=799918 P1K87_RS14805 WP_003152043.1 3010620..3010760(-) (degQ) [Bacillus amyloliquefaciens strain MG-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=799918 P1K87_RS14805 WP_003152043.1 3010620..3010760(-) (degQ) [Bacillus amyloliquefaciens strain MG-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |