Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   RDV59_RS00295 Genome accession   NZ_CP133476
Coordinates   49559..49789 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain LMG 11489     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 44559..54789
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDV59_RS00260 (RDV59_00260) - 44953..45399 (-) 447 WP_037605837.1 hypothetical protein -
  RDV59_RS00265 (RDV59_00265) - 45473..46129 (-) 657 WP_002887011.1 CPBP family intramembrane glutamic endopeptidase -
  RDV59_RS00270 (RDV59_00270) - 46141..46338 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  RDV59_RS00275 (RDV59_00275) - 46589..47782 (-) 1194 WP_002885831.1 acetate kinase -
  RDV59_RS00280 (RDV59_00280) comGH 47839..48795 (-) 957 WP_038676858.1 class I SAM-dependent methyltransferase Machinery gene
  RDV59_RS00285 (RDV59_00285) comGG 48840..49157 (-) 318 WP_002887013.1 competence type IV pilus minor pilin ComGG Machinery gene
  RDV59_RS00290 (RDV59_00290) comGF 49135..49572 (-) 438 WP_002887014.1 competence type IV pilus minor pilin ComGF Machinery gene
  RDV59_RS00295 (RDV59_00295) comGE 49559..49789 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  RDV59_RS00300 (RDV59_00300) comGD 49821..50249 (-) 429 WP_254593949.1 competence type IV pilus minor pilin ComGD Machinery gene
  RDV59_RS00305 (RDV59_00305) comGC 50209..50523 (-) 315 WP_170314557.1 competence type IV pilus major pilin ComGC Machinery gene
  RDV59_RS00310 (RDV59_00310) comGB 50532..51632 (-) 1101 WP_126405090.1 competence type IV pilus assembly protein ComGB Machinery gene
  RDV59_RS00315 (RDV59_00315) comGA/cglA/cilD 51514..52455 (-) 942 WP_038676863.1 competence type IV pilus ATPase ComGA Machinery gene
  RDV59_RS00320 (RDV59_00320) - 52535..52897 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=799641 RDV59_RS00295 WP_002887015.1 49559..49789(-) (comGE) [Streptococcus salivarius strain LMG 11489]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=799641 RDV59_RS00295 WP_002887015.1 49559..49789(-) (comGE) [Streptococcus salivarius strain LMG 11489]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382