Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   RDV58_RS02405 Genome accession   NZ_CP133475
Coordinates   475723..475869 (-) Length   48 a.a.
NCBI ID   WP_002280232.1    Uniprot ID   -
Organism   Streptococcus mutans strain LMG 14558     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 470723..480869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RDV58_RS02385 (RDV58_02385) - 471720..472346 (+) 627 WP_002265453.1 hypothetical protein -
  RDV58_RS02390 (RDV58_02390) - 472393..473031 (+) 639 WP_002265117.1 VTT domain-containing protein -
  RDV58_RS02395 (RDV58_02395) comE/blpR 473512..474264 (+) 753 WP_002280234.1 response regulator transcription factor Regulator
  RDV58_RS02400 (RDV58_02400) comD/blpH 474261..475586 (+) 1326 WP_002280233.1 sensor histidine kinase Regulator
  RDV58_RS02405 (RDV58_02405) comC/blpC 475723..475869 (-) 147 WP_002280232.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  RDV58_RS02410 (RDV58_02410) - 476136..476357 (+) 222 WP_002312090.1 Blp family class II bacteriocin -
  RDV58_RS02415 (RDV58_02415) - 476388..476606 (+) 219 WP_025985888.1 Blp family class II bacteriocin -
  RDV58_RS02420 (RDV58_02420) - 476692..477096 (+) 405 WP_002280427.1 hypothetical protein -
  RDV58_RS02425 (RDV58_02425) - 477219..477431 (-) 213 Protein_446 IS3 family transposase -
  RDV58_RS02430 (RDV58_02430) - 477871..478035 (+) 165 WP_002265308.1 hypothetical protein -
  RDV58_RS02435 (RDV58_02435) - 478419..478610 (+) 192 WP_002312088.1 Blp family class II bacteriocin -
  RDV58_RS02440 (RDV58_02440) - 478774..478962 (+) 189 WP_002280338.1 Blp family class II bacteriocin -
  RDV58_RS02445 (RDV58_02445) - 479447..480475 (+) 1029 WP_002280337.1 thioredoxin family protein -

Sequence


Protein


Download         Length: 48 a.a.        Molecular weight: 5464.37 Da        Isoelectric Point: 10.7837

>NTDB_id=799552 RDV58_RS02405 WP_002280232.1 475723..475869(-) (comC/blpC) [Streptococcus mutans strain LMG 14558]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGKIR

Nucleotide


Download         Length: 147 bp        

>NTDB_id=799552 RDV58_RS02405 WP_002280232.1 475723..475869(-) (comC/blpC) [Streptococcus mutans strain LMG 14558]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAAACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGGAAAATAAGATAG

Domains


Predicted by InterProScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

95.833

0.937