Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   P0M22_RS11690 Genome accession   NZ_CP119399
Coordinates   2440128..2440442 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain HBXN2020     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2435128..2445442
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P0M22_RS11645 (P0M22_11645) sinI 2435809..2435982 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  P0M22_RS11650 (P0M22_11650) sinR 2436016..2436351 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P0M22_RS11655 (P0M22_11655) - 2436399..2437184 (-) 786 WP_032874027.1 TasA family protein -
  P0M22_RS11660 (P0M22_11660) - 2437249..2437833 (-) 585 WP_032874025.1 signal peptidase I -
  P0M22_RS11665 (P0M22_11665) tapA 2437805..2438476 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  P0M22_RS11670 (P0M22_11670) - 2438735..2439064 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  P0M22_RS11675 (P0M22_11675) - 2439105..2439284 (-) 180 WP_022552966.1 YqzE family protein -
  P0M22_RS11680 (P0M22_11680) comGG 2439341..2439718 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  P0M22_RS11685 (P0M22_11685) comGF 2439719..2440219 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  P0M22_RS11690 (P0M22_11690) comGE 2440128..2440442 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  P0M22_RS11695 (P0M22_11695) comGD 2440426..2440863 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  P0M22_RS11700 (P0M22_11700) comGC 2440853..2441161 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  P0M22_RS11705 (P0M22_11705) comGB 2441166..2442203 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  P0M22_RS11710 (P0M22_11710) comGA 2442190..2443260 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  P0M22_RS11715 (P0M22_11715) - 2443457..2444407 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=798979 P0M22_RS11690 WP_032874016.1 2440128..2440442(-) (comGE) [Bacillus velezensis strain HBXN2020]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=798979 P0M22_RS11690 WP_032874016.1 2440128..2440442(-) (comGE) [Bacillus velezensis strain HBXN2020]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481