Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   Q7Q33_RS16370 Genome accession   NZ_CP133412
Coordinates   3054747..3054887 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain KK001     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3049747..3059887
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7Q33_RS16345 (Q7Q33_16335) yuxO 3050060..3050440 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  Q7Q33_RS16350 (Q7Q33_16340) comA 3050459..3051103 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  Q7Q33_RS16355 (Q7Q33_16345) comP 3051184..3053493 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  Q7Q33_RS16360 (Q7Q33_16350) comX 3053508..3053675 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  Q7Q33_RS16365 (Q7Q33_16355) comQ 3053663..3054562 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  Q7Q33_RS16370 (Q7Q33_16360) degQ 3054747..3054887 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  Q7Q33_RS16375 (Q7Q33_16365) - 3055109..3055234 (+) 126 WP_003228793.1 hypothetical protein -
  Q7Q33_RS16380 (Q7Q33_16370) - 3055348..3055716 (+) 369 WP_003243784.1 hypothetical protein -
  Q7Q33_RS16385 (Q7Q33_16375) pdeH 3055692..3056921 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  Q7Q33_RS16390 (Q7Q33_16380) pncB 3057058..3058530 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  Q7Q33_RS16395 (Q7Q33_16385) pncA 3058546..3059097 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  Q7Q33_RS16400 (Q7Q33_16390) yueI 3059194..3059592 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=798922 Q7Q33_RS16370 WP_003220708.1 3054747..3054887(-) (degQ) [Bacillus subtilis strain KK001]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=798922 Q7Q33_RS16370 WP_003220708.1 3054747..3054887(-) (degQ) [Bacillus subtilis strain KK001]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1