Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   Q7Q33_RS12800 Genome accession   NZ_CP133412
Coordinates   2395191..2395364 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain KK001     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2390191..2400364
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7Q33_RS12785 (Q7Q33_12785) gcvT 2390990..2392078 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  Q7Q33_RS12790 (Q7Q33_12790) hepAA 2392520..2394193 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  Q7Q33_RS12795 (Q7Q33_12795) yqhG 2394214..2395008 (+) 795 WP_003230200.1 YqhG family protein -
  Q7Q33_RS12800 (Q7Q33_12800) sinI 2395191..2395364 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  Q7Q33_RS12805 (Q7Q33_12805) sinR 2395398..2395733 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Q7Q33_RS12810 (Q7Q33_12810) tasA 2395826..2396611 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  Q7Q33_RS12815 (Q7Q33_12815) sipW 2396675..2397247 (-) 573 WP_003246088.1 signal peptidase I SipW -
  Q7Q33_RS12820 (Q7Q33_12820) tapA 2397231..2397992 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  Q7Q33_RS12825 (Q7Q33_12825) yqzG 2398264..2398590 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  Q7Q33_RS12830 (Q7Q33_12830) spoIITA 2398632..2398811 (-) 180 WP_003230176.1 YqzE family protein -
  Q7Q33_RS12835 (Q7Q33_12835) comGG 2398882..2399256 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  Q7Q33_RS12840 (Q7Q33_12840) comGF 2399257..2399640 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  Q7Q33_RS12845 (Q7Q33_12845) comGE 2399666..2400013 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=798886 Q7Q33_RS12800 WP_003230187.1 2395191..2395364(+) (sinI) [Bacillus subtilis strain KK001]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=798886 Q7Q33_RS12800 WP_003230187.1 2395191..2395364(+) (sinI) [Bacillus subtilis strain KK001]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1