Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   PY824_RS06510 Genome accession   NZ_CP119172
Coordinates   1210907..1211347 (-) Length   146 a.a.
NCBI ID   WP_014294718.1    Uniprot ID   A0AAP8G025
Organism   Streptococcus macedonicus strain SGM CIP105683     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1205634..1226877 1210907..1211347 within 0


Gene organization within MGE regions


Location: 1205634..1226877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PY824_RS06490 (PY824_06490) - 1205634..1206086 (-) 453 WP_039670887.1 MarR family winged helix-turn-helix transcriptional regulator -
  PY824_RS06495 (PY824_06495) - 1206076..1207061 (-) 986 Protein_1213 zinc-binding dehydrogenase -
  PY824_RS06500 (PY824_06500) rcrQ 1207327..1209099 (-) 1773 WP_014294716.1 ABC transporter ATP-binding protein Regulator
  PY824_RS06505 (PY824_06505) rcrP 1209089..1210903 (-) 1815 WP_014294717.1 ABC transporter ATP-binding protein Regulator
  PY824_RS06510 (PY824_06510) rcrR 1210907..1211347 (-) 441 WP_014294718.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  PY824_RS06515 (PY824_06515) - 1211523..1211933 (-) 411 WP_014294719.1 peptide deformylase -
  PY824_RS06520 (PY824_06520) - 1211930..1212439 (-) 510 WP_039670888.1 GNAT family N-acetyltransferase -
  PY824_RS06525 (PY824_06525) gdhA 1212716..1214068 (-) 1353 WP_039670889.1 NADP-specific glutamate dehydrogenase -
  PY824_RS06530 (PY824_06530) - 1214314..1214811 (+) 498 WP_039670890.1 DUF308 domain-containing protein -
  PY824_RS06535 (PY824_06535) queF 1214867..1215358 (-) 492 WP_014294723.1 preQ(1) synthase -
  PY824_RS06540 (PY824_06540) queE 1215371..1216087 (-) 717 WP_099390341.1 7-carboxy-7-deazaguanine synthase QueE -
  PY824_RS06545 (PY824_06545) queD 1216077..1216523 (-) 447 WP_014294725.1 6-carboxytetrahydropterin synthase QueD -
  PY824_RS06550 (PY824_06550) queC 1216516..1217175 (-) 660 WP_014294726.1 7-cyano-7-deazaguanine synthase QueC -
  PY824_RS06555 (PY824_06555) - 1217420..1219186 (-) 1767 WP_014294727.1 ABC transporter ATP-binding protein -
  PY824_RS06560 (PY824_06560) - 1219189..1220928 (-) 1740 WP_014294728.1 ABC transporter ATP-binding protein -
  PY824_RS06565 (PY824_06565) - 1221006..1222877 (-) 1872 WP_039670891.1 ABC-F family ATP-binding cassette domain-containing protein -
  PY824_RS06570 (PY824_06570) - 1222874..1224079 (-) 1206 WP_039670892.1 CCA tRNA nucleotidyltransferase -
  PY824_RS06575 (PY824_06575) dapB 1224076..1224843 (-) 768 WP_014294731.1 4-hydroxy-tetrahydrodipicolinate reductase -
  PY824_RS06580 (PY824_06580) - 1224863..1225711 (-) 849 WP_039670893.1 DegV family protein -
  PY824_RS06585 (PY824_06585) - 1225711..1226091 (-) 381 WP_039670894.1 DUF1149 family protein -
  PY824_RS06590 (PY824_06590) - 1226218..1226877 (-) 660 WP_039670915.1 glucosaminidase domain-containing protein -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17144.66 Da        Isoelectric Point: 9.8372

>NTDB_id=798057 PY824_RS06510 WP_014294718.1 1210907..1211347(-) (rcrR) [Streptococcus macedonicus strain SGM CIP105683]
MHKKDPFSQFRDFINLMENRVHALAESYGVENLAGPQGFAVLYLRDNPDKEIYIKDIEKRLRISKSVTSNLIKRMEKNGF
IQVVSSKEDKRYKQVVLTELGKSKAQNIQDFHDEIHRQILAGVDHEDLKISFRVFNRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=798057 PY824_RS06510 WP_014294718.1 1210907..1211347(-) (rcrR) [Streptococcus macedonicus strain SGM CIP105683]
ATGCACAAGAAAGATCCGTTTTCACAGTTTAGGGATTTTATCAATTTAATGGAAAATCGTGTCCATGCCCTTGCGGAAAG
TTATGGTGTTGAAAATCTGGCTGGCCCACAGGGATTTGCGGTATTGTATCTTCGTGATAATCCCGATAAAGAAATTTATA
TCAAGGACATTGAGAAGAGACTAAGAATTTCAAAGTCAGTGACTAGTAATTTGATTAAGCGCATGGAGAAAAATGGTTTT
ATCCAAGTTGTTTCGTCGAAAGAAGATAAGCGTTATAAGCAAGTGGTGTTGACTGAACTTGGAAAATCAAAGGCTCAGAA
TATTCAAGATTTCCATGATGAAATTCATAGGCAAATCTTAGCTGGTGTTGACCATGAGGATCTCAAAATCTCGTTTCGCG
TCTTTAACCGCATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

55.245

97.945

0.541