Detailed information NTG0797046

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYW35_RS06235
• Genome accession: NZ_CP118974
• Coordinates: 1231082..1231399 (+)
• Length: 105 a.a.
• NCBI ID: WP_016911890.1
• Uniprot ID: -
• Organism: Mammaliicoccus vitulinus strain DSM 15615
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1226082..1236399

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW35_RS06195	-	1226226..1226417 (+)	192	WP_016911882.1	YqgQ family protein	-
PYW35_RS06200	-	1226414..1227385 (+)	972	WP_016911883.1	ROK family glucokinase	-
PYW35_RS06205	-	1227385..1227699 (+)	315	WP_016911884.1	MTH1187 family thiamine-binding protein	-
PYW35_RS06210	-	1227729..1227968 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
PYW35_RS06215	-	1228068..1228700 (+)	633	WP_016911886.1	MBL fold metallo-hydrolase	-
PYW35_RS06220	-	1228737..1228982 (-)	246	WP_016911887.1	DUF2626 family protein	-
PYW35_RS06225	comGA	1229136..1230038 (+)	903	WP_103323129.1	competence type IV pilus ATPase ComGA	Machinery gene
PYW35_RS06230	comGB	1230031..1231068 (+)	1038	WP_204107810.1	competence type IV pilus assembly protein ComGB	-
PYW35_RS06235	comGC	1231082..1231399 (+)	318	WP_016911890.1	competence type IV pilus major pilin ComGC	Machinery gene
PYW35_RS06240	comGD	1231399..1231827 (+)	429	WP_103323612.1	competence type IV pilus minor pilin ComGD	-
PYW35_RS06245	comGE	1231811..1232092 (+)	282	WP_016911892.1	competence type IV pilus minor pilin ComGE	-
PYW35_RS06250	comGF	1232067..1232501 (+)	435	WP_204107811.1	competence type IV pilus minor pilin ComGF	-
PYW35_RS06255	-	1232736..1233224 (+)	489	WP_103323613.1	shikimate kinase	-
PYW35_RS06260	gcvT	1233417..1234505 (+)	1089	WP_103323614.1	glycine cleavage system aminomethyltransferase GcvT	-
PYW35_RS06265	gcvPA	1234517..1235860 (+)	1344	WP_103323615.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11536.67 Da
• Isoelectric Point: 8.2633

>NTDB_id=797046 PYW35_RS06235 WP_016911890.1 1231082..1231399(+) (comGC) [Mammaliicoccus vitulinus strain DSM 15615]
MKKFKLLCKKEGFTLIEMLIVLLIISILLIIIIPNISKQSETVKSTGCQAQIKMVAGQVEAYTLKHDAKPNSVNDLVSDG
YINEKQLTCKSGESITLQNGEVVAN

Nucleotide

• Length: 318 bp

>NTDB_id=797046 PYW35_RS06235 WP_016911890.1 1231082..1231399(+) (comGC) [Mammaliicoccus vitulinus strain DSM 15615]
ATGAAAAAGTTTAAATTGCTATGTAAAAAAGAAGGGTTTACTTTAATCGAGATGTTGATAGTGCTTTTGATCATAAGCAT
TTTGTTAATCATCATCATACCTAATATTAGCAAACAATCAGAAACTGTTAAAAGCACTGGATGCCAAGCACAAATTAAGA
TGGTAGCTGGACAAGTAGAAGCATATACGTTAAAGCATGATGCTAAACCGAACTCAGTTAATGATTTAGTAAGTGATGGG
TATATAAATGAAAAGCAATTAACGTGTAAATCAGGTGAGAGCATTACATTACAAAATGGAGAAGTCGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC/cglC	Streptococcus mitis SK321	41.748	98.095	0.41
comGC	Bacillus subtilis subsp. subtilis str. 168	46.237	88.571	0.41
comGC/cglC	Streptococcus pneumoniae Rx1	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae D39	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae R6	40.777	98.095	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	40.777	98.095	0.4
comYC	Streptococcus mutans UA159	48.276	82.857	0.4
comYC	Streptococcus mutans UA140	48.276	82.857	0.4
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	44.944	84.762	0.381
comYC	Streptococcus gordonii str. Challis substr. CH1	45.349	81.905	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	45.882	80.952	0.371