Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PXG99_RS19600 Genome accession   NZ_CP118911
Coordinates   3910757..3910897 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain XRD006     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3905757..3915897
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PXG99_RS19575 (PXG99_19575) - 3906060..3906458 (+) 399 WP_029973800.1 DUF1694 domain-containing protein -
  PXG99_RS19580 (PXG99_19580) - 3906555..3907106 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  PXG99_RS19585 (PXG99_19585) - 3907124..3908590 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  PXG99_RS19590 (PXG99_19590) - 3908720..3909943 (+) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  PXG99_RS19595 (PXG99_19595) - 3909950..3910291 (-) 342 WP_014418765.1 hypothetical protein -
  PXG99_RS19600 (PXG99_19600) degQ 3910757..3910897 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PXG99_RS19605 (PXG99_19605) - 3911082..3911960 (+) 879 WP_032860494.1 polyprenyl synthetase family protein -
  PXG99_RS19610 (PXG99_19610) comX 3911960..3912124 (+) 165 WP_007613432.1 competence pheromone ComX -
  PXG99_RS19615 (PXG99_19615) comP 3912136..3914427 (+) 2292 WP_029973797.1 histidine kinase Regulator
  PXG99_RS19620 (PXG99_19620) comA 3914508..3915152 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  PXG99_RS19625 (PXG99_19625) - 3915174..3915557 (+) 384 WP_014418761.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=796276 PXG99_RS19600 WP_003152043.1 3910757..3910897(+) (degQ) [Bacillus velezensis strain XRD006]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=796276 PXG99_RS19600 WP_003152043.1 3910757..3910897(+) (degQ) [Bacillus velezensis strain XRD006]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891