Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   PWO55_RS01385 Genome accession   NZ_CP118770
Coordinates   282140..282259 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain IMD4036     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 277140..287259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWO55_RS01370 (PWO55_01375) - 278752..279435 (+) 684 WP_003156341.1 response regulator transcription factor -
  PWO55_RS01375 (PWO55_01380) - 279422..280855 (+) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  PWO55_RS01380 (PWO55_01385) rapC 281008..282156 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  PWO55_RS01385 (PWO55_01390) phrC 282140..282259 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  PWO55_RS01390 (PWO55_01395) - 282410..282520 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  PWO55_RS01395 (PWO55_01400) - 282600..283964 (-) 1365 WP_060657805.1 aspartate kinase -
  PWO55_RS01400 (PWO55_01405) ceuB 284379..285332 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  PWO55_RS01405 (PWO55_01410) - 285322..286269 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  PWO55_RS01410 (PWO55_01415) - 286263..287021 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=795021 PWO55_RS01385 WP_003156334.1 282140..282259(+) (phrC) [Bacillus velezensis strain IMD4036]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=795021 PWO55_RS01385 WP_003156334.1 282140..282259(+) (phrC) [Bacillus velezensis strain IMD4036]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718