Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PWG69_RS16985 Genome accession   NZ_CP118744
Coordinates   3371034..3371174 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain RP01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3366034..3376174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWG69_RS16960 (PWG69_16960) - 3366327..3366716 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  PWG69_RS16965 (PWG69_16965) comA 3366733..3367371 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  PWG69_RS16970 (PWG69_16970) comP 3367458..3369773 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  PWG69_RS16975 (PWG69_16975) comX 3369794..3369964 (-) 171 WP_020452790.1 competence pheromone ComX -
  PWG69_RS16980 (PWG69_16980) - 3369936..3370847 (-) 912 WP_059231526.1 polyprenyl synthetase family protein -
  PWG69_RS16985 (PWG69_16985) degQ 3371034..3371174 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  PWG69_RS16990 (PWG69_16990) - 3371786..3372007 (+) 222 WP_230368259.1 hypothetical protein -
  PWG69_RS16995 (PWG69_16995) - 3372050..3373270 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  PWG69_RS17000 (PWG69_17000) - 3373448..3374917 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  PWG69_RS17005 (PWG69_17005) - 3374935..3375486 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  PWG69_RS17010 (PWG69_17010) - 3375672..3376073 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=794914 PWG69_RS16985 WP_003184860.1 3371034..3371174(-) (degQ) [Bacillus paralicheniformis strain RP01]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=794914 PWG69_RS16985 WP_003184860.1 3371034..3371174(-) (degQ) [Bacillus paralicheniformis strain RP01]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652