Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PWG69_RS13325 Genome accession   NZ_CP118744
Coordinates   2683153..2683329 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain RP01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2678153..2688329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWG69_RS13310 (PWG69_13310) gcvT 2678793..2679887 (-) 1095 WP_079289191.1 glycine cleavage system aminomethyltransferase GcvT -
  PWG69_RS13315 (PWG69_13315) - 2680482..2682161 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  PWG69_RS13320 (PWG69_13320) - 2682168..2682962 (+) 795 WP_020452164.1 YqhG family protein -
  PWG69_RS13325 (PWG69_13325) sinI 2683153..2683329 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  PWG69_RS13330 (PWG69_13330) sinR 2683363..2683698 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  PWG69_RS13335 (PWG69_13335) tasA 2683803..2684597 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  PWG69_RS13340 (PWG69_13340) sipW 2684670..2685254 (-) 585 WP_023855186.1 signal peptidase I SipW -
  PWG69_RS13345 (PWG69_13345) tapA 2685251..2685979 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  PWG69_RS13350 (PWG69_13350) - 2686257..2686577 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  PWG69_RS13355 (PWG69_13355) - 2686607..2686789 (-) 183 WP_025811164.1 YqzE family protein -
  PWG69_RS13360 (PWG69_13360) comGG 2686877..2687242 (-) 366 WP_026579313.1 competence type IV pilus minor pilin ComGG -
  PWG69_RS13365 (PWG69_13365) comGF 2687254..2687742 (-) 489 WP_229078638.1 competence type IV pilus minor pilin ComGF -
  PWG69_RS13370 (PWG69_13370) comGE 2687651..2687998 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=794897 PWG69_RS13325 WP_023855184.1 2683153..2683329(+) (sinI) [Bacillus paralicheniformis strain RP01]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=794897 PWG69_RS13325 WP_023855184.1 2683153..2683329(+) (sinI) [Bacillus paralicheniformis strain RP01]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5