Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | Q7618_RS02640 | Genome accession | NZ_CP131715 |
| Coordinates | 510615..510764 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 2006C08-243 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 505615..515764
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7618_RS02590 | comA/nlmT | 505661..506248 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| Q7618_RS02595 (Q7618_02585) | blpI | 506530..506727 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| Q7618_RS02600 (Q7618_02590) | blpJ | 507194..507463 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| Q7618_RS02605 (Q7618_02595) | blpU | 507532..507762 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| Q7618_RS02610 (Q7618_02600) | - | 507765..507884 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| Q7618_RS02615 (Q7618_02605) | - | 508181..508345 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| Q7618_RS02620 (Q7618_02610) | - | 508342..508746 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| Q7618_RS02625 (Q7618_02615) | - | 508944..509748 (+) | 805 | Protein_516 | IS5 family transposase | - |
| Q7618_RS02630 (Q7618_02620) | blpM | 509898..510152 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| Q7618_RS02635 (Q7618_02625) | blpN | 510168..510371 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| Q7618_RS02640 (Q7618_02630) | cipB | 510615..510764 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| Q7618_RS02645 (Q7618_02635) | - | 510868..510987 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| Q7618_RS02650 (Q7618_02640) | - | 511773..512192 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| Q7618_RS02655 (Q7618_02645) | - | 512207..512896 (+) | 690 | WP_000760521.1 | CPBP family intramembrane glutamic endopeptidase | - |
| Q7618_RS02660 (Q7618_02650) | blpZ | 512938..513171 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| Q7618_RS02665 (Q7618_02655) | - | 513502..514848 (+) | 1347 | WP_001837384.1 | IS1380-like element ISSpn5 family transposase | - |
| Q7618_RS02670 (Q7618_02660) | - | 515030..515641 (+) | 612 | WP_000638370.1 | type II CAAX endopeptidase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=791983 Q7618_RS02640 WP_001809846.1 510615..510764(+) (cipB) [Streptococcus pneumoniae strain 2006C08-243]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=791983 Q7618_RS02640 WP_001809846.1 510615..510764(+) (cipB) [Streptococcus pneumoniae strain 2006C08-243]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |