Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   Q7619_RS02640 Genome accession   NZ_CP131714
Coordinates   511000..511149 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 2008C04-309     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 506000..516149
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7619_RS02590 comA/nlmT 506046..506633 (-) 588 WP_001810228.1 cysteine peptidase family C39 domain-containing protein Regulator
  Q7619_RS02595 (Q7619_02585) blpI 506915..507112 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  Q7619_RS02600 (Q7619_02590) blpJ 507579..507848 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  Q7619_RS02605 (Q7619_02595) blpU 507917..508147 (+) 231 WP_000379964.1 bacteriocin-like peptide BlpU -
  Q7619_RS02610 (Q7619_02600) - 508150..508269 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  Q7619_RS02615 (Q7619_02605) - 508566..508730 (+) 165 WP_000727118.1 hypothetical protein -
  Q7619_RS02620 (Q7619_02610) - 508727..509131 (+) 405 WP_000846944.1 hypothetical protein -
  Q7619_RS02625 (Q7619_02615) - 509329..510133 (+) 805 Protein_516 IS5 family transposase -
  Q7619_RS02630 (Q7619_02620) blpM 510283..510537 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  Q7619_RS02635 (Q7619_02625) blpN 510553..510756 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  Q7619_RS02640 (Q7619_02630) cipB 511000..511149 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  Q7619_RS02645 (Q7619_02635) - 511253..511372 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  Q7619_RS02650 (Q7619_02640) - 512158..512577 (+) 420 WP_000877385.1 hypothetical protein -
  Q7619_RS02655 (Q7619_02645) - 512592..513281 (+) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  Q7619_RS02660 (Q7619_02650) blpZ 513323..513556 (+) 234 WP_000276498.1 immunity protein BlpZ -
  Q7619_RS02665 (Q7619_02655) - 513887..515233 (+) 1347 WP_001838554.1 IS1380-like element ISSpn5 family transposase -
  Q7619_RS02670 (Q7619_02660) - 515415..516026 (+) 612 WP_000638370.1 type II CAAX endopeptidase family protein -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=791861 Q7619_RS02640 WP_001809846.1 511000..511149(+) (cipB) [Streptococcus pneumoniae strain 2008C04-309]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=791861 Q7619_RS02640 WP_001809846.1 511000..511149(+) (cipB) [Streptococcus pneumoniae strain 2008C04-309]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531