Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | Q7619_RS02640 | Genome accession | NZ_CP131714 |
| Coordinates | 511000..511149 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 2008C04-309 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 506000..516149
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7619_RS02590 | comA/nlmT | 506046..506633 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| Q7619_RS02595 (Q7619_02585) | blpI | 506915..507112 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| Q7619_RS02600 (Q7619_02590) | blpJ | 507579..507848 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| Q7619_RS02605 (Q7619_02595) | blpU | 507917..508147 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| Q7619_RS02610 (Q7619_02600) | - | 508150..508269 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| Q7619_RS02615 (Q7619_02605) | - | 508566..508730 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| Q7619_RS02620 (Q7619_02610) | - | 508727..509131 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| Q7619_RS02625 (Q7619_02615) | - | 509329..510133 (+) | 805 | Protein_516 | IS5 family transposase | - |
| Q7619_RS02630 (Q7619_02620) | blpM | 510283..510537 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| Q7619_RS02635 (Q7619_02625) | blpN | 510553..510756 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| Q7619_RS02640 (Q7619_02630) | cipB | 511000..511149 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| Q7619_RS02645 (Q7619_02635) | - | 511253..511372 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| Q7619_RS02650 (Q7619_02640) | - | 512158..512577 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| Q7619_RS02655 (Q7619_02645) | - | 512592..513281 (+) | 690 | WP_000760521.1 | CPBP family intramembrane glutamic endopeptidase | - |
| Q7619_RS02660 (Q7619_02650) | blpZ | 513323..513556 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| Q7619_RS02665 (Q7619_02655) | - | 513887..515233 (+) | 1347 | WP_001838554.1 | IS1380-like element ISSpn5 family transposase | - |
| Q7619_RS02670 (Q7619_02660) | - | 515415..516026 (+) | 612 | WP_000638370.1 | type II CAAX endopeptidase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=791861 Q7619_RS02640 WP_001809846.1 511000..511149(+) (cipB) [Streptococcus pneumoniae strain 2008C04-309]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=791861 Q7619_RS02640 WP_001809846.1 511000..511149(+) (cipB) [Streptococcus pneumoniae strain 2008C04-309]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |