Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   JL003_RS05760 Genome accession   NZ_AP022815
Coordinates   1178883..1179512 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain JE86-ST05     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1158171..1196550 1178883..1179512 within 0


Gene organization within MGE regions


Location: 1158171..1196550
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JL003_RS05670 (JE86ST05C_11060) elfG 1159552..1160622 (+) 1071 WP_001165655.1 fimbrial protein -
  JL003_RS05675 (JE86ST05C_11070) ycbU 1160634..1161176 (+) 543 WP_000730614.1 fimbrial protein -
  JL003_RS05680 (JE86ST05C_11080) ycbV 1161184..1161699 (+) 516 WP_096855666.1 fimbrial protein -
  JL003_RS05685 (JE86ST05C_11090) ycbF 1161665..1162402 (+) 738 WP_001111459.1 fimbrial chaperone -
  JL003_RS05690 (JE86ST05C_11100) pyrD 1162513..1163523 (+) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  JL003_RS05695 (JE86ST05C_11110) zapC 1163697..1164239 (+) 543 WP_001295353.1 cell division protein ZapC -
  JL003_RS05700 (JE86ST05C_11120) ycbX 1164236..1165345 (-) 1110 WP_000224273.1 6-N-hydroxylaminopurine resistance protein YcbX -
  JL003_RS05705 (JE86ST05C_11130) rlmKL 1165589..1167697 (+) 2109 WP_001086520.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  JL003_RS05710 (JE86ST05C_11140) uup 1167709..1169616 (+) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  JL003_RS05715 (JE86ST05C_11150) pqiA 1169746..1170999 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  JL003_RS05720 (JE86ST05C_11160) pqiB 1171004..1172644 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  JL003_RS05725 (JE86ST05C_11170) pqiC 1172641..1173204 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  JL003_RS05730 (JE86ST05C_11180) rmf 1173460..1173627 (+) 168 WP_000828648.1 ribosome modulation factor -
  JL003_RS05735 (JE86ST05C_11190) fabA 1173697..1174215 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  JL003_RS05740 (JE86ST05C_11200) ycbZ 1174284..1176044 (-) 1761 WP_000156526.1 AAA family ATPase -
  JL003_RS05745 (JE86ST05C_11210) matP 1176230..1176682 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  JL003_RS05750 (JE86ST05C_11220) ompA 1176758..1177798 (-) 1041 WP_000750416.1 porin OmpA -
  JL003_RS05755 (JE86ST05C_11240) sulA 1178155..1178664 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  JL003_RS05760 (JE86ST05C_11250) sxy/tfoX 1178883..1179512 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  JL003_RS05765 (JE86ST05C_11260) yccS 1179475..1181637 (-) 2163 WP_000875044.1 YccS family putative transporter -
  JL003_RS05770 (JE86ST05C_11270) yccF 1181647..1182093 (-) 447 WP_001261231.1 YccF domain-containing protein -
  JL003_RS05775 (JE86ST05C_11280) helD 1182216..1184270 (+) 2055 WP_000420533.1 DNA helicase IV -
  JL003_RS05780 (JE86ST05C_11290) mgsA 1184302..1184760 (-) 459 WP_000424181.1 methylglyoxal synthase -
  JL003_RS05785 (JE86ST05C_11300) csgI 1184856..1185518 (-) 663 WP_000847791.1 DUF2057 family protein -
  JL003_RS05790 (JE86ST05C_11320) yccU 1185691..1186104 (+) 414 WP_000665217.1 CoA-binding protein -
  JL003_RS05795 (JE86ST05C_11330) hspQ 1186149..1186466 (-) 318 WP_001295356.1 heat shock protein HspQ -
  JL003_RS05800 (JE86ST05C_11340) rlmI 1186524..1187714 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  JL003_RS05805 (JE86ST05C_11350) yccX 1187809..1188087 (+) 279 WP_000048243.1 acylphosphatase -
  JL003_RS05810 (JE86ST05C_11360) tusE 1188084..1188413 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  JL003_RS05815 (JE86ST05C_11370) yccA 1188504..1189163 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  JL003_RS05820 (JE86ST05C_11380) - 1189571..1190590 (-) 1020 WP_001563016.1 tyrosine-type recombinase/integrase -
  JL003_RS05825 (JE86ST05C_11390) - 1190568..1190810 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  JL003_RS05830 (JE86ST05C_11400) - 1190878..1193349 (-) 2472 WP_137473685.1 exonuclease -
  JL003_RS05835 (JE86ST05C_11410) - 1193445..1193633 (-) 189 WP_000199480.1 DUF1482 family protein -
  JL003_RS05840 (JE86ST05C_11420) dicB 1193630..1193818 (-) 189 WP_000449172.1 cell division inhibition protein DicB -
  JL003_RS05845 (JE86ST05C_11430) - 1194442..1194672 (+) 231 WP_225380399.1 hypothetical protein -
  JL003_RS05850 (JE86ST05C_11440) - 1194632..1195033 (-) 402 WP_001625307.1 hypothetical protein -
  JL003_RS05855 (JE86ST05C_11450) - 1195045..1195197 (-) 153 WP_001345283.1 DUF1391 family protein -
  JL003_RS05860 (JE86ST05C_11460) - 1195462..1195881 (-) 420 WP_000362153.1 hypothetical protein -
  JL003_RS05865 (JE86ST05C_11470) - 1195982..1196263 (+) 282 WP_001625303.1 transcriptional regulator -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=79186 JL003_RS05760 WP_000839153.1 1178883..1179512(+) (sxy/tfoX) [Escherichia coli strain JE86-ST05]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=79186 JL003_RS05760 WP_000839153.1 1178883..1179512(+) (sxy/tfoX) [Escherichia coli strain JE86-ST05]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment