Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   JLZ98_RS05555 Genome accession   NZ_AP022811
Coordinates   1152055..1152684 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain JE86-ST02     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1131343..1169643 1152055..1152684 within 0


Gene organization within MGE regions


Location: 1131343..1169643
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JLZ98_RS05465 (JE86ST02C_10520) elfG 1132724..1133794 (+) 1071 WP_001165655.1 fimbrial protein -
  JLZ98_RS05470 (JE86ST02C_10530) ycbU 1133806..1134348 (+) 543 WP_000730614.1 fimbrial protein -
  JLZ98_RS05475 (JE86ST02C_10540) ycbV 1134356..1134871 (+) 516 WP_096855666.1 fimbrial protein -
  JLZ98_RS05480 (JE86ST02C_10550) ycbF 1134837..1135574 (+) 738 WP_001111459.1 fimbrial chaperone -
  JLZ98_RS05485 (JE86ST02C_10560) pyrD 1135685..1136695 (+) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  JLZ98_RS05490 (JE86ST02C_10570) zapC 1136869..1137411 (+) 543 WP_001295353.1 cell division protein ZapC -
  JLZ98_RS05495 (JE86ST02C_10580) ycbX 1137408..1138517 (-) 1110 WP_000224273.1 6-N-hydroxylaminopurine resistance protein YcbX -
  JLZ98_RS05500 (JE86ST02C_10590) rlmKL 1138761..1140869 (+) 2109 WP_001086520.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  JLZ98_RS05505 (JE86ST02C_10600) uup 1140881..1142788 (+) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  JLZ98_RS05510 (JE86ST02C_10610) pqiA 1142918..1144171 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  JLZ98_RS05515 (JE86ST02C_10620) pqiB 1144176..1145816 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  JLZ98_RS05520 (JE86ST02C_10630) pqiC 1145813..1146376 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  JLZ98_RS05525 (JE86ST02C_10640) rmf 1146632..1146799 (+) 168 WP_000828648.1 ribosome modulation factor -
  JLZ98_RS05530 (JE86ST02C_10650) fabA 1146869..1147387 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  JLZ98_RS05535 (JE86ST02C_10660) ycbZ 1147456..1149216 (-) 1761 WP_000156526.1 Lon protease family protein -
  JLZ98_RS05540 (JE86ST02C_10670) matP 1149402..1149854 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  JLZ98_RS05545 (JE86ST02C_10680) ompA 1149930..1150970 (-) 1041 WP_000750416.1 porin OmpA -
  JLZ98_RS05550 (JE86ST02C_10700) sulA 1151327..1151836 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  JLZ98_RS05555 (JE86ST02C_10710) sxy/tfoX 1152055..1152684 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  JLZ98_RS05560 (JE86ST02C_10720) yccS 1152647..1154809 (-) 2163 WP_000875044.1 YccS family putative transporter -
  JLZ98_RS05565 (JE86ST02C_10730) yccF 1154819..1155265 (-) 447 WP_001261231.1 YccF domain-containing protein -
  JLZ98_RS05570 (JE86ST02C_10740) helD 1155388..1157442 (+) 2055 WP_000420533.1 DNA helicase IV -
  JLZ98_RS05575 (JE86ST02C_10750) mgsA 1157474..1157932 (-) 459 WP_000424181.1 methylglyoxal synthase -
  JLZ98_RS05580 (JE86ST02C_10760) yccT 1158028..1158690 (-) 663 WP_000847791.1 DUF2057 family protein -
  JLZ98_RS05585 (JE86ST02C_10780) yccU 1158863..1159276 (+) 414 WP_000665217.1 CoA-binding protein -
  JLZ98_RS05590 (JE86ST02C_10790) hspQ 1159321..1159638 (-) 318 WP_001295356.1 heat shock protein HspQ -
  JLZ98_RS05595 (JE86ST02C_10800) rlmI 1159696..1160886 (-) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  JLZ98_RS05600 (JE86ST02C_10810) yccX 1160981..1161259 (+) 279 WP_000048243.1 acylphosphatase -
  JLZ98_RS05605 (JE86ST02C_10820) tusE 1161256..1161585 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  JLZ98_RS05610 (JE86ST02C_10830) yccA 1161676..1162335 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  JLZ98_RS05615 (JE86ST02C_10840) - 1162743..1163762 (-) 1020 WP_200984382.1 tyrosine-type recombinase/integrase -
  JLZ98_RS05620 (JE86ST02C_10850) - 1163740..1163982 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  JLZ98_RS05625 (JE86ST02C_10860) - 1164050..1166521 (-) 2472 WP_200984383.1 exonuclease -
  JLZ98_RS05630 (JE86ST02C_10870) - 1166617..1166805 (-) 189 WP_000199480.1 DUF1482 family protein -
  JLZ98_RS05635 (JE86ST02C_10880) dicB 1166802..1166990 (-) 189 WP_000449172.1 cell division inhibition protein DicB -
  JLZ98_RS05640 (JE86ST02C_10900) ydfC 1167556..1167774 (-) 219 WP_001171951.1 protein YdfC -
  JLZ98_RS28095 (JE86ST02C_10910) ydfB 1167804..1167932 (-) 129 WP_000344964.1 protein YdfB -
  JLZ98_RS05645 (JE86ST02C_10920) - 1167934..1168089 (-) 156 WP_000379589.1 DUF1391 family protein -
  JLZ98_RS05650 (JE86ST02C_10930) - 1168362..1169078 (-) 717 WP_000103687.1 S24 family peptidase -
  JLZ98_RS05655 (JE86ST02C_10940) - 1169128..1169343 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=79164 JLZ98_RS05555 WP_000839153.1 1152055..1152684(+) (sxy/tfoX) [Escherichia coli strain JE86-ST02]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=79164 JLZ98_RS05555 WP_000839153.1 1152055..1152684(+) (sxy/tfoX) [Escherichia coli strain JE86-ST02]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1


Multiple sequence alignment