Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   Q7626_RS02415 Genome accession   NZ_CP131707
Coordinates   482927..483076 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain 2018C08-270     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 477927..488076
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7626_RS02390 (Q7626_02385) - 479544..479747 (+) 204 WP_001093272.1 bacteriocin class II family protein -
  Q7626_RS02395 (Q7626_02390) - 480065..480268 (+) 204 WP_000411016.1 hypothetical protein -
  Q7626_RS02400 (Q7626_02395) - 481271..482060 (+) 790 Protein_471 IS5 family transposase -
  Q7626_RS02405 (Q7626_02400) blpM 482210..482464 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  Q7626_RS02410 (Q7626_02405) blpN 482480..482683 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  Q7626_RS02415 (Q7626_02410) cipB 482927..483076 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  Q7626_RS02420 (Q7626_02415) - 483180..483299 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  Q7626_RS02425 (Q7626_02420) - 484085..484468 (+) 384 WP_000877381.1 hypothetical protein -
  Q7626_RS02430 (Q7626_02425) - 484520..485209 (+) 690 WP_000760528.1 CPBP family intramembrane glutamic endopeptidase -
  Q7626_RS02435 (Q7626_02430) blpZ 485251..485499 (+) 249 WP_000276501.1 immunity protein BlpZ -
  Q7626_RS02440 (Q7626_02435) - 485529..486140 (+) 612 WP_000394035.1 type II CAAX endopeptidase family protein -
  Q7626_RS02445 (Q7626_02440) - 486301..487095 (+) 795 WP_000363002.1 phosphotransferase family protein -
  Q7626_RS02450 (Q7626_02445) trmB 487092..487727 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=791036 Q7626_RS02415 WP_001818346.1 482927..483076(+) (cipB) [Streptococcus pneumoniae strain 2018C08-270]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=791036 Q7626_RS02415 WP_001818346.1 482927..483076(+) (cipB) [Streptococcus pneumoniae strain 2018C08-270]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51