Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | Q7627_RS02675 | Genome accession | NZ_CP131706 |
| Coordinates | 514449..514598 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 2018N21-288 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 509449..519598
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7627_RS02625 | comA/nlmT | 509495..510082 (-) | 588 | WP_001810228.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| Q7627_RS02630 (Q7627_02620) | blpI | 510364..510561 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| Q7627_RS02635 (Q7627_02625) | blpJ | 511028..511297 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| Q7627_RS02640 (Q7627_02630) | blpU | 511366..511596 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| Q7627_RS02645 (Q7627_02635) | - | 511599..511718 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| Q7627_RS02650 (Q7627_02640) | - | 512015..512179 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| Q7627_RS02655 (Q7627_02645) | - | 512176..512580 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| Q7627_RS02660 (Q7627_02650) | - | 512778..513582 (+) | 805 | Protein_523 | IS5 family transposase | - |
| Q7627_RS02665 (Q7627_02655) | blpM | 513732..513986 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| Q7627_RS02670 (Q7627_02660) | blpN | 514002..514205 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| Q7627_RS02675 (Q7627_02665) | cipB | 514449..514598 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| Q7627_RS02680 (Q7627_02670) | - | 514702..514821 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| Q7627_RS02685 (Q7627_02675) | - | 515607..516026 (+) | 420 | WP_000877385.1 | hypothetical protein | - |
| Q7627_RS02690 (Q7627_02680) | - | 516041..516730 (+) | 690 | WP_341945023.1 | lysostaphin resistance A-like protein | - |
| Q7627_RS02695 (Q7627_02685) | blpZ | 516772..517005 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| Q7627_RS02700 (Q7627_02690) | - | 517336..518682 (+) | 1347 | WP_001808790.1 | IS1380-like element ISSpn5 family transposase | - |
| Q7627_RS02705 (Q7627_02695) | - | 518864..519475 (+) | 612 | WP_000638370.1 | type II CAAX endopeptidase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=790917 Q7627_RS02675 WP_001809846.1 514449..514598(+) (cipB) [Streptococcus pneumoniae strain 2018N21-288]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=790917 Q7627_RS02675 WP_001809846.1 514449..514598(+) (cipB) [Streptococcus pneumoniae strain 2018N21-288]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |