Detailed information NTG0789526

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: PUW76_RS07995
• Genome accession: NZ_CP118048
• Coordinates: 1663157..1663432 (-)
• Length: 91 a.a.
• NCBI ID: WP_002366896.1
• Uniprot ID: -
• Organism: Enterococcus faecalis strain VSI48
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1658157..1668432

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW76_RS07960 (PUW76_07960)	-	1658719..1659192 (+)	474	WP_002357065.1	universal stress protein	-
PUW76_RS07965 (PUW76_07965)	-	1659297..1660484 (-)	1188	WP_002357064.1	acetate kinase	-
PUW76_RS07970 (PUW76_07970)	-	1660509..1661516 (-)	1008	WP_033600640.1	class I SAM-dependent methyltransferase	-
PUW76_RS07975 (PUW76_07975)	comGG	1661645..1661998 (-)	354	WP_002362054.1	competence type IV pilus minor pilin ComGG	-
PUW76_RS07980 (PUW76_07980)	comGF	1661998..1662432 (-)	435	WP_002357060.1	competence type IV pilus minor pilin ComGF	-
PUW76_RS07985 (PUW76_07985)	-	1662422..1662748 (-)	327	WP_002419696.1	type II secretion system protein	-
PUW76_RS07990 (PUW76_07990)	comGD	1662714..1663160 (-)	447	WP_002419697.1	competence type IV pilus minor pilin ComGD	-
PUW76_RS07995 (PUW76_07995)	comGC/cglC	1663157..1663432 (-)	276	WP_002366896.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW76_RS08000 (PUW76_08000)	comGB	1663432..1664478 (-)	1047	WP_033600639.1	competence type IV pilus assembly protein ComGB	-
PUW76_RS08005 (PUW76_08005)	comGA	1664435..1665403 (-)	969	WP_002374519.1	competence type IV pilus ATPase ComGA	-
PUW76_RS08010 (PUW76_08010)	-	1665646..1666974 (-)	1329	WP_010816624.1	amino acid permease	-
PUW76_RS08015 (PUW76_08015)	rlmN	1667265..1668338 (-)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10492.43 Da
• Isoelectric Point: 9.3340

>NTDB_id=789526 PUW76_RS07995 WP_002366896.1 1663157..1663432(-) (comGC/cglC) [Enterococcus faecalis strain VSI48]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=789526 PUW76_RS07995 WP_002366896.1 1663157..1663432(-) (comGC/cglC) [Enterococcus faecalis strain VSI48]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTGGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAGGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAACAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	48.101	86.813	0.418
comGC	Staphylococcus aureus N315	48.101	86.813	0.418
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396