Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   PUW62_RS07675 Genome accession   NZ_CP118046
Coordinates   1537047..1537340 (-) Length   97 a.a.
NCBI ID   WP_150890982.1    Uniprot ID   -
Organism   Streptococcus anginosus strain VSI52     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1533393..1550155 1537047..1537340 within 0


Gene organization within MGE regions


Location: 1533393..1550155
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUW62_RS07660 (PUW62_07660) recR 1533393..1533989 (-) 597 WP_003023742.1 recombination mediator RecR -
  PUW62_RS07665 (PUW62_07665) pbp2b 1534000..1536060 (-) 2061 WP_180364008.1 penicillin-binding protein PBP2B -
  PUW62_RS07670 (PUW62_07670) - 1536410..1536955 (-) 546 WP_150890984.1 hypothetical protein -
  PUW62_RS07675 (PUW62_07675) HI0659 1537047..1537340 (-) 294 WP_150890982.1 helix-turn-helix transcriptional regulator Machinery gene
  PUW62_RS07680 (PUW62_07680) - 1537330..1537695 (-) 366 WP_006268450.1 type II toxin-antitoxin system RelE/ParE family toxin -
  PUW62_RS07685 (PUW62_07685) - 1537761..1538036 (-) 276 WP_150890980.1 terminase small subunit -
  PUW62_RS07690 (PUW62_07690) - 1538116..1538346 (-) 231 WP_022525741.1 hypothetical protein -
  PUW62_RS07695 (PUW62_07695) - 1538578..1538988 (-) 411 WP_150890979.1 hypothetical protein -
  PUW62_RS07700 (PUW62_07700) - 1538981..1539457 (-) 477 WP_150890977.1 hypothetical protein -
  PUW62_RS07705 (PUW62_07705) - 1539504..1540115 (-) 612 WP_150890975.1 enoyl-CoA hydratase/isomerase family protein -
  PUW62_RS07710 (PUW62_07710) - 1540204..1540377 (-) 174 WP_164232034.1 hypothetical protein -
  PUW62_RS07715 (PUW62_07715) - 1540521..1541366 (-) 846 WP_150890974.1 ATP-binding protein -
  PUW62_RS07720 (PUW62_07720) - 1541381..1542187 (-) 807 WP_150890972.1 phage replisome organizer N-terminal domain-containing protein -
  PUW62_RS07725 (PUW62_07725) - 1542196..1542462 (-) 267 WP_150890970.1 HTH domain-containing protein -
  PUW62_RS07730 (PUW62_07730) - 1542651..1542923 (-) 273 WP_150890966.1 hypothetical protein -
  PUW62_RS07735 (PUW62_07735) - 1542979..1543596 (-) 618 Protein_1490 Rha family transcriptional regulator -
  PUW62_RS07740 (PUW62_07740) - 1543955..1544143 (-) 189 WP_150890964.1 DNA-binding protein -
  PUW62_RS07745 (PUW62_07745) - 1544301..1544846 (+) 546 WP_150890962.1 helix-turn-helix transcriptional regulator -
  PUW62_RS07750 (PUW62_07750) - 1544924..1546087 (+) 1164 WP_150890960.1 site-specific integrase -
  PUW62_RS07755 (PUW62_07755) - 1546247..1546939 (-) 693 WP_003023729.1 phosphoglycerate mutase -
  PUW62_RS07760 (PUW62_07760) - 1547081..1547542 (-) 462 WP_024052825.1 Fur family transcriptional regulator -
  PUW62_RS07765 (PUW62_07765) - 1547735..1548010 (-) 276 WP_003023726.1 HU family DNA-binding protein -
  PUW62_RS07770 (PUW62_07770) - 1548139..1548972 (-) 834 WP_024052826.1 DegV family protein -
  PUW62_RS07775 (PUW62_07775) - 1549202..1550155 (+) 954 WP_024052827.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10811.48 Da        Isoelectric Point: 4.9123

>NTDB_id=789482 PUW62_RS07675 WP_150890982.1 1537047..1537340(-) (HI0659) [Streptococcus anginosus strain VSI52]
MKNSAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNERGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLDKTLAVVPLEREQV

Nucleotide


Download         Length: 294 bp        

>NTDB_id=789482 PUW62_RS07675 WP_150890982.1 1537047..1537340(-) (HI0659) [Streptococcus anginosus strain VSI52]
ATGAAAAATAGTGCAATTGGTAGTAACTGGAAAGATGTAAGAGCTGAGTTATTCAGCAAAGAAGAAATTTTAGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGGAATGAAAGGGGCATTAGTCAAAAAAAACTAGAGGAGCTGA
GTGGCGTTAGTCAGCCAGTCATAGCTAGAATGGAGACAGGAAAAACAAGCCCACAGCTTGATACAGTATTAAAGGTTTTG
GCAAGTCTTGATAAGACTTTAGCGGTTGTACCACTAGAGCGTGAACAAGTCTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

58.242

93.814

0.546