Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   PUN35_RS01550 Genome accession   NZ_CP117986
Coordinates   293807..294217 (+) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. N3378-2at     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 270921..298850 293807..294217 within 0


Gene organization within MGE regions


Location: 270921..298850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUN35_RS01390 - 270921..271101 (+) 181 Protein_273 hypothetical protein -
  PUN35_RS01395 - 271410..271640 (+) 231 WP_224588644.1 hypothetical protein -
  PUN35_RS01400 - 271785..272033 (+) 249 Protein_275 hypothetical protein -
  PUN35_RS01405 - 271996..272118 (+) 123 Protein_276 RusA family crossover junction endodeoxyribonuclease -
  PUN35_RS01410 - 272201..272353 (+) 153 WP_049832653.1 XtrA/YqaO family protein -
  PUN35_RS01415 - 272492..272758 (-) 267 WP_033881358.1 hypothetical protein -
  PUN35_RS01420 - 273375..273854 (+) 480 WP_014480344.1 hypothetical protein -
  PUN35_RS01430 - 274247..274552 (-) 306 WP_123772463.1 hypothetical protein -
  PUN35_RS01435 terS 274679..275243 (+) 565 Protein_281 phage terminase small subunit -
  PUN35_RS01440 - 275203..275678 (+) 476 Protein_282 phage tail tube protein -
  PUN35_RS01445 - 275965..276051 (-) 87 WP_072592549.1 putative holin-like toxin -
  PUN35_RS22445 - 276226..276392 (+) 167 Protein_284 peptidoglycan-binding domain-containing protein -
  PUN35_RS01455 istB 276644..277402 (-) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  PUN35_RS01460 istA 277399..278946 (-) 1548 WP_014480339.1 IS21 family transposase -
  PUN35_RS01465 - 279787..280077 (-) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  PUN35_RS01470 - 280187..280764 (-) 578 Protein_288 suppressor of fused domain protein -
  PUN35_RS01475 - 281032..281265 (-) 234 WP_224588641.1 hypothetical protein -
  PUN35_RS01480 - 281354..281557 (+) 204 WP_123772462.1 hypothetical protein -
  PUN35_RS01485 - 281865..282377 (-) 513 WP_014477426.1 hypothetical protein -
  PUN35_RS01490 cdiI 282449..282808 (-) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  PUN35_RS01495 - 282905..283357 (-) 453 WP_014480333.1 SMI1/KNR4 family protein -
  PUN35_RS01500 - 283456..283896 (-) 441 WP_014480332.1 SMI1/KNR4 family protein -
  PUN35_RS01505 - 284299..284586 (-) 288 WP_014480331.1 hypothetical protein -
  PUN35_RS22450 - 284600..285307 (-) 708 WP_014480330.1 hypothetical protein -
  PUN35_RS22455 - 285693..286526 (-) 834 Protein_297 ribonuclease YeeF family protein -
  PUN35_RS01515 - 286708..287835 (+) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  PUN35_RS01520 - 288575..288970 (-) 396 WP_014480327.1 VOC family protein -
  PUN35_RS01525 - 289912..290802 (-) 891 WP_014480326.1 LysR family transcriptional regulator -
  PUN35_RS01530 fumC 290969..292357 (+) 1389 WP_014480325.1 class II fumarate hydratase -
  PUN35_RS01535 - 292576..292788 (+) 213 Protein_302 recombinase family protein -
  PUN35_RS01540 - 292785..292883 (-) 99 WP_031600702.1 hypothetical protein -
  PUN35_RS01545 sigK 292883..293611 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  PUN35_RS01550 nucA/comI 293807..294217 (+) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  PUN35_RS01555 - 294250..294972 (-) 723 WP_014480321.1 hypothetical protein -
  PUN35_RS01560 gnd 295223..296116 (+) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  PUN35_RS01565 - 296135..296761 (-) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  PUN35_RS01570 cwlH 296948..297700 (+) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  PUN35_RS01575 - 297952..298683 (+) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=788868 PUN35_RS01550 WP_009967785.1 293807..294217(+) (nucA/comI) [Bacillus sp. N3378-2at]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=788868 PUN35_RS01550 WP_009967785.1 293807..294217(+) (nucA/comI) [Bacillus sp. N3378-2at]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529