Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   PS038_RS13585 Genome accession   NZ_CP117609
Coordinates   2819408..2820037 (-) Length   209 a.a.
NCBI ID   WP_059218545.1    Uniprot ID   -
Organism   Escherichia albertii strain BIA_26     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2794341..2826588 2819408..2820037 within 0


Gene organization within MGE regions


Location: 2794341..2826588
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PS038_RS13435 (PS038_13435) - 2795197..2795475 (-) 279 WP_273818290.1 hypothetical protein -
  PS038_RS13440 (PS038_13440) - 2795578..2796681 (-) 1104 WP_000401169.1 helix-turn-helix domain-containing protein -
  PS038_RS13445 (PS038_13445) - 2796662..2797312 (-) 651 WP_001004961.1 hypothetical protein -
  PS038_RS13450 (PS038_13450) hokD 2797478..2797633 (-) 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
  PS038_RS13455 (PS038_13455) - 2797705..2798778 (+) 1074 WP_001178384.1 IS481 family transposase -
  PS038_RS24520 - 2798994..2799077 (-) 84 Protein_2640 hypothetical protein -
  PS038_RS13460 (PS038_13460) - 2799337..2800110 (+) 774 WP_000160655.1 alpha/beta hydrolase -
  PS038_RS13465 (PS038_13465) - 2800462..2800875 (-) 414 WP_001151233.1 DUF977 family protein -
  PS038_RS13470 (PS038_13470) - 2800916..2801986 (-) 1071 WP_273818114.1 phage replisome organizer -
  PS038_RS13475 (PS038_13475) - 2802058..2802483 (-) 426 WP_059215642.1 toxin YdaT family protein -
  PS038_RS13480 (PS038_13480) - 2802467..2802748 (-) 282 WP_000391948.1 transcriptional regulator -
  PS038_RS13485 (PS038_13485) - 2802849..2803268 (+) 420 WP_087891676.1 hypothetical protein -
  PS038_RS13490 (PS038_13490) - 2803533..2803685 (+) 153 WP_273818115.1 DUF1391 family protein -
  PS038_RS13495 (PS038_13495) - 2803697..2804335 (+) 639 WP_059222115.1 hypothetical protein -
  PS038_RS13500 (PS038_13500) - 2804336..2804545 (-) 210 WP_273818116.1 hypothetical protein -
  PS038_RS13505 (PS038_13505) dicB 2805113..2805301 (+) 189 WP_273818118.1 cell division inhibition protein DicB -
  PS038_RS13510 (PS038_13510) - 2805298..2805489 (+) 192 WP_001090222.1 DUF1482 family protein -
  PS038_RS13515 (PS038_13515) - 2805583..2808042 (+) 2460 WP_273818119.1 exonuclease -
  PS038_RS13520 (PS038_13520) - 2808109..2808360 (+) 252 WP_273818120.1 DUF4224 domain-containing protein -
  PS038_RS13525 (PS038_13525) - 2808329..2809348 (+) 1020 WP_273818121.1 tyrosine-type recombinase/integrase -
  PS038_RS13530 (PS038_13530) yccA 2809757..2810416 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  PS038_RS13535 (PS038_13535) tusE 2810508..2810837 (+) 330 WP_024164819.1 sulfurtransferase TusE -
  PS038_RS13540 (PS038_13540) yccX 2810834..2811112 (-) 279 WP_000048219.1 acylphosphatase -
  PS038_RS13545 (PS038_13545) rlmI 2811206..2812396 (+) 1191 WP_000116313.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  PS038_RS13550 (PS038_13550) hspQ 2812454..2812771 (+) 318 WP_001295356.1 heat shock protein HspQ -
  PS038_RS13555 (PS038_13555) - 2812816..2813229 (-) 414 WP_002462360.1 CoA-binding protein -
  PS038_RS13560 (PS038_13560) - 2813402..2814064 (+) 663 WP_000847777.1 DUF2057 family protein -
  PS038_RS13565 (PS038_13565) mgsA 2814160..2814618 (+) 459 WP_000424182.1 methylglyoxal synthase -
  PS038_RS13570 (PS038_13570) helD 2814650..2816704 (-) 2055 WP_025237257.1 DNA helicase IV -
  PS038_RS13575 (PS038_13575) - 2816827..2817273 (+) 447 WP_001261228.1 YccF domain-containing protein -
  PS038_RS13580 (PS038_13580) yccS 2817283..2819445 (+) 2163 WP_072248756.1 YccS family putative transporter -
  PS038_RS13585 (PS038_13585) sxy/tfoX 2819408..2820037 (-) 630 WP_059218545.1 TfoX/Sxy family DNA transformation protein Regulator
  PS038_RS13590 (PS038_13590) sulA 2820255..2820764 (+) 510 WP_000288703.1 SOS-induced cell division inhibitor SulA -
  PS038_RS13595 (PS038_13595) ompA 2821120..2822172 (+) 1053 WP_024164823.1 porin OmpA -
  PS038_RS13600 (PS038_13600) matP 2822247..2822699 (-) 453 WP_273818122.1 macrodomain Ter protein MatP -
  PS038_RS13605 (PS038_13605) - 2822885..2824645 (+) 1761 WP_059218546.1 AAA family ATPase -
  PS038_RS13610 (PS038_13610) fabA 2824714..2825232 (+) 519 WP_002462364.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  PS038_RS13615 (PS038_13615) rmf 2825301..2825468 (-) 168 WP_000828648.1 ribosome modulation factor -
  PS038_RS13620 (PS038_13620) pqiC 2825725..2826288 (-) 564 WP_000759093.1 membrane integrity-associated transporter subunit PqiC -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24323.27 Da        Isoelectric Point: 9.0264

>NTDB_id=786637 PS038_RS13585 WP_059218545.1 2819408..2820037(-) (sxy/tfoX) [Escherichia albertii strain BIA_26]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVNDTVFAMVADGELYLRACEQSVQYCVKHPPVWLTYKKCGRPVTLN
YYRVDESLWRNQQKLVRLSKYSLDAALKEKCTRNNLQRLKDLPNMSYHLEAILGEVGIKDVRTLRILGAKMCWLRLRQHN
SQVTEKILFMLEGAIIDIHEAALPVARRQELAEWAESIMPKPEFPTEPE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=786637 PS038_RS13585 WP_059218545.1 2819408..2820037(-) (sxy/tfoX) [Escherichia albertii strain BIA_26]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAGTCACAAGAATACCTTGCAACGTTAGGCACCATTGAATATCGATCGCT
GTTTGGCAGTTACAGTTTGACGGTTAACGATACGGTATTTGCGATGGTTGCTGATGGTGAGTTGTATCTACGGGCTTGTG
AACAAAGCGTACAGTACTGTGTAAAACATCCGCCAGTCTGGCTGACATATAAAAAGTGCGGCCGACCCGTGACTCTCAAT
TACTACCGGGTTGATGAAAGTTTATGGCGTAACCAACAGAAATTAGTTCGCTTGTCGAAATATTCCCTGGATGCTGCGCT
GAAAGAGAAATGTACGCGCAACAATCTCCAGCGACTGAAAGATTTGCCGAATATGTCTTATCATCTGGAGGCGATTCTCG
GTGAAGTGGGGATCAAGGATGTGCGGACTTTACGGATCCTTGGCGCAAAAATGTGCTGGTTGCGACTACGTCAGCATAAT
AGCCAGGTGACGGAGAAGATCTTATTCATGCTTGAAGGCGCAATTATTGATATTCATGAAGCAGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCTGAATGGGCTGAATCTATTATGCCGAAACCGGAGTTTCCGACGGAACCTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

90.431

100

0.904