Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLID5_RS11020 Genome accession   NZ_AP025701
Coordinates   2283362..2283646 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis strain ID-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2278362..2288646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLID5_RS10990 (LLID5_21630) - 2278799..2279176 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLID5_RS10995 (LLID5_21640) - 2279380..2280246 (+) 867 WP_251918763.1 RluA family pseudouridine synthase -
  LLID5_RS11000 (LLID5_21650) - 2280289..2281098 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLID5_RS11005 (LLID5_21660) - 2281091..2281828 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLID5_RS11010 (LLID5_21670) - 2282005..2282847 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLID5_RS11015 (LLID5_21680) - 2282844..2283281 (-) 438 WP_251918765.1 zinc-dependent MarR family transcriptional regulator -
  LLID5_RS11020 (LLID5_21690) comGG 2283362..2283646 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLID5_RS11025 (LLID5_21700) comGF 2283685..2284110 (-) 426 WP_161935022.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLID5_RS11030 (LLID5_21710) comGE 2284094..2284390 (-) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLID5_RS11035 (LLID5_21720) comGD 2284362..2284793 (-) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLID5_RS11040 (LLID5_21730) comGC 2284753..2285136 (-) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  LLID5_RS11045 (LLID5_21740) comGB 2285150..2286169 (-) 1020 WP_251918767.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLID5_RS11050 (LLID5_21750) comGA 2286117..2287055 (-) 939 WP_033900707.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=78661 LLID5_RS11020 WP_017865155.1 2283362..2283646(-) (comGG) [Lactococcus lactis strain ID-5]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=78661 LLID5_RS11020 WP_017865155.1 2283362..2283646(-) (comGG) [Lactococcus lactis strain ID-5]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596


Multiple sequence alignment