Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | PO847_RS16205 | Genome accession | NZ_CP117197 |
| Coordinates | 3229502..3229642 (-) | Length | 46 a.a. |
| NCBI ID | WP_278103729.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain 3ZT | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3224502..3234642
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO847_RS16180 (PO847_16180) | - | 3224842..3225225 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| PO847_RS16185 (PO847_16185) | comA | 3225247..3225891 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| PO847_RS16190 (PO847_16190) | comP | 3225972..3228263 (-) | 2292 | WP_022553709.1 | histidine kinase | Regulator |
| PO847_RS16195 (PO847_16195) | comX | 3228275..3228439 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| PO847_RS16200 (PO847_16200) | - | 3228439..3229317 (-) | 879 | WP_032860494.1 | polyprenyl synthetase family protein | - |
| PO847_RS16205 (PO847_16205) | degQ | 3229502..3229642 (-) | 141 | WP_278103729.1 | degradation enzyme regulation protein DegQ | Regulator |
| PO847_RS16210 (PO847_16210) | - | 3230108..3230449 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| PO847_RS16215 (PO847_16215) | - | 3230456..3231679 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| PO847_RS16220 (PO847_16220) | - | 3231809..3233275 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| PO847_RS16225 (PO847_16225) | - | 3233293..3233844 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| PO847_RS16230 (PO847_16230) | - | 3233941..3234339 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5552.32 Da Isoelectric Point: 4.9432
>NTDB_id=782793 PO847_RS16205 WP_278103729.1 3229502..3229642(-) (degQ) [Bacillus velezensis strain 3ZT]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKFS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKFS
Nucleotide
Download Length: 141 bp
>NTDB_id=782793 PO847_RS16205 WP_278103729.1 3229502..3229642(-) (degQ) [Bacillus velezensis strain 3ZT]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAATTTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAATTTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
86.957 |
100 |
0.87 |