Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   PO847_RS01970 Genome accession   NZ_CP117197
Coordinates   393430..393549 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 3ZT     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 388430..398549
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO847_RS01955 (PO847_01955) - 390042..390725 (+) 684 WP_022552587.1 response regulator transcription factor -
  PO847_RS01960 (PO847_01960) - 390712..392139 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  PO847_RS01965 (PO847_01965) rapC 392298..393446 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  PO847_RS01970 (PO847_01970) phrC 393430..393549 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  PO847_RS01975 (PO847_01975) - 393701..393796 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  PO847_RS01980 (PO847_01980) - 393891..395255 (-) 1365 WP_021495117.1 aspartate kinase -
  PO847_RS01985 (PO847_01985) ceuB 395669..396622 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  PO847_RS01990 (PO847_01990) - 396612..397559 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  PO847_RS01995 (PO847_01995) - 397553..398311 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=782741 PO847_RS01970 WP_003156334.1 393430..393549(+) (phrC) [Bacillus velezensis strain 3ZT]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=782741 PO847_RS01970 WP_003156334.1 393430..393549(+) (phrC) [Bacillus velezensis strain 3ZT]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718