Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | PO767_RS16020 | Genome accession | NZ_CP117182 |
| Coordinates | 3199927..3200067 (-) | Length | 46 a.a. |
| NCBI ID | WP_278103729.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain Lwp6 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3194927..3205067
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO767_RS15995 | - | 3195267..3195650 (-) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
| PO767_RS16000 | comA | 3195672..3196316 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| PO767_RS16005 | comP | 3196397..3198688 (-) | 2292 | WP_022553709.1 | histidine kinase | Regulator |
| PO767_RS16010 | comX | 3198700..3198864 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| PO767_RS16015 | - | 3198864..3199742 (-) | 879 | WP_032860494.1 | polyprenyl synthetase family protein | - |
| PO767_RS16020 | degQ | 3199927..3200067 (-) | 141 | WP_278103729.1 | degradation enzyme regulation protein DegQ | Regulator |
| PO767_RS16025 | - | 3200533..3200874 (+) | 342 | WP_014418765.1 | hypothetical protein | - |
| PO767_RS16030 | - | 3200881..3202104 (-) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| PO767_RS16035 | - | 3202234..3203700 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| PO767_RS16040 | - | 3203718..3204269 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| PO767_RS16045 | - | 3204366..3204764 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5552.32 Da Isoelectric Point: 4.9432
>NTDB_id=782627 PO767_RS16020 WP_278103729.1 3199927..3200067(-) (degQ) [Bacillus velezensis strain Lwp6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKFS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKFS
Nucleotide
Download Length: 141 bp
>NTDB_id=782627 PO767_RS16020 WP_278103729.1 3199927..3200067(-) (degQ) [Bacillus velezensis strain Lwp6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAATTTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAATTTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
86.957 |
100 |
0.87 |