Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | Q3O83_RS15200 | Genome accession | NZ_CP130445 |
| Coordinates | 3072116..3072256 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain C6.7 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3067116..3077256
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q3O83_RS15175 (Q3O83_15175) | - | 3067413..3067796 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| Q3O83_RS15180 (Q3O83_15180) | comA | 3067818..3068462 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| Q3O83_RS15185 (Q3O83_15185) | - | 3068543..3070846 (-) | 2304 | Protein_2929 | histidine kinase | - |
| Q3O83_RS15190 (Q3O83_15190) | comX | 3070866..3071045 (-) | 180 | WP_306383677.1 | competence pheromone ComX | Regulator |
| Q3O83_RS15195 (Q3O83_15195) | comQ | 3070999..3071985 (-) | 987 | WP_269321599.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| Q3O83_RS15200 (Q3O83_15200) | degQ | 3072116..3072256 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| Q3O83_RS15205 (Q3O83_15205) | - | 3072722..3073063 (+) | 342 | WP_003152040.1 | hypothetical protein | - |
| Q3O83_RS15210 (Q3O83_15210) | - | 3073070..3074290 (-) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| Q3O83_RS15215 (Q3O83_15215) | - | 3074420..3075886 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| Q3O83_RS15220 (Q3O83_15220) | - | 3075904..3076455 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| Q3O83_RS15225 (Q3O83_15225) | - | 3076552..3076950 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=781963 Q3O83_RS15200 WP_003152043.1 3072116..3072256(-) (degQ) [Bacillus amyloliquefaciens strain C6.7]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=781963 Q3O83_RS15200 WP_003152043.1 3072116..3072256(-) (degQ) [Bacillus amyloliquefaciens strain C6.7]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |