Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   Q3O83_RS15200 Genome accession   NZ_CP130445
Coordinates   3072116..3072256 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain C6.7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3067116..3077256
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3O83_RS15175 (Q3O83_15175) - 3067413..3067796 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  Q3O83_RS15180 (Q3O83_15180) comA 3067818..3068462 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  Q3O83_RS15185 (Q3O83_15185) - 3068543..3070846 (-) 2304 Protein_2929 histidine kinase -
  Q3O83_RS15190 (Q3O83_15190) comX 3070866..3071045 (-) 180 WP_306383677.1 competence pheromone ComX Regulator
  Q3O83_RS15195 (Q3O83_15195) comQ 3070999..3071985 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  Q3O83_RS15200 (Q3O83_15200) degQ 3072116..3072256 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  Q3O83_RS15205 (Q3O83_15205) - 3072722..3073063 (+) 342 WP_003152040.1 hypothetical protein -
  Q3O83_RS15210 (Q3O83_15210) - 3073070..3074290 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  Q3O83_RS15215 (Q3O83_15215) - 3074420..3075886 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  Q3O83_RS15220 (Q3O83_15220) - 3075904..3076455 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  Q3O83_RS15225 (Q3O83_15225) - 3076552..3076950 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=781963 Q3O83_RS15200 WP_003152043.1 3072116..3072256(-) (degQ) [Bacillus amyloliquefaciens strain C6.7]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=781963 Q3O83_RS15200 WP_003152043.1 3072116..3072256(-) (degQ) [Bacillus amyloliquefaciens strain C6.7]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891