Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OSR41_RS17235 Genome accession   NZ_CP116941
Coordinates   3283844..3283984 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain GN02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3278844..3288984
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OSR41_RS17210 (OSR41_17210) - 3279141..3279530 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  OSR41_RS17215 (OSR41_17215) comA 3279547..3280185 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  OSR41_RS17220 (OSR41_17220) comP 3280272..3282578 (-) 2307 WP_272714603.1 ATP-binding protein Regulator
  OSR41_RS17225 (OSR41_17225) comX 3282601..3282765 (-) 165 WP_003184853.1 competence pheromone ComX -
  OSR41_RS17230 (OSR41_17230) - 3282774..3283655 (-) 882 WP_003184856.1 polyprenyl synthetase family protein -
  OSR41_RS17235 (OSR41_17235) degQ 3283844..3283984 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  OSR41_RS17240 (OSR41_17240) - 3284470..3284817 (+) 348 WP_009329512.1 hypothetical protein -
  OSR41_RS17245 (OSR41_17245) - 3284860..3286080 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  OSR41_RS17250 (OSR41_17250) - 3286259..3287728 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  OSR41_RS17255 (OSR41_17255) - 3287746..3288297 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  OSR41_RS17260 (OSR41_17260) - 3288482..3288883 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=781453 OSR41_RS17235 WP_003184860.1 3283844..3283984(-) (degQ) [Bacillus licheniformis strain GN02]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=781453 OSR41_RS17235 WP_003184860.1 3283844..3283984(-) (degQ) [Bacillus licheniformis strain GN02]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652