Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | OSR41_RS17235 | Genome accession | NZ_CP116941 |
| Coordinates | 3283844..3283984 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus licheniformis strain GN02 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3278844..3288984
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSR41_RS17210 (OSR41_17210) | - | 3279141..3279530 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| OSR41_RS17215 (OSR41_17215) | comA | 3279547..3280185 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| OSR41_RS17220 (OSR41_17220) | comP | 3280272..3282578 (-) | 2307 | WP_272714603.1 | ATP-binding protein | Regulator |
| OSR41_RS17225 (OSR41_17225) | comX | 3282601..3282765 (-) | 165 | WP_003184853.1 | competence pheromone ComX | - |
| OSR41_RS17230 (OSR41_17230) | - | 3282774..3283655 (-) | 882 | WP_003184856.1 | polyprenyl synthetase family protein | - |
| OSR41_RS17235 (OSR41_17235) | degQ | 3283844..3283984 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| OSR41_RS17240 (OSR41_17240) | - | 3284470..3284817 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| OSR41_RS17245 (OSR41_17245) | - | 3284860..3286080 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| OSR41_RS17250 (OSR41_17250) | - | 3286259..3287728 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| OSR41_RS17255 (OSR41_17255) | - | 3287746..3288297 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| OSR41_RS17260 (OSR41_17260) | - | 3288482..3288883 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=781453 OSR41_RS17235 WP_003184860.1 3283844..3283984(-) (degQ) [Bacillus licheniformis strain GN02]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=781453 OSR41_RS17235 WP_003184860.1 3283844..3283984(-) (degQ) [Bacillus licheniformis strain GN02]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |