Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QZH48_RS11510 Genome accession   NZ_CP129879
Coordinates   2340312..2340587 (-) Length   91 a.a.
NCBI ID   WP_021721873.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain CAB701     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2335312..2345587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QZH48_RS11480 (QZH48_11480) - 2335752..2336129 (-) 378 WP_038602343.1 pyridoxamine 5'-phosphate oxidase family protein -
  QZH48_RS11485 (QZH48_11485) - 2336334..2337200 (+) 867 WP_098394207.1 RluA family pseudouridine synthase -
  QZH48_RS11490 (QZH48_11490) - 2337238..2338047 (-) 810 WP_038602349.1 metal ABC transporter permease -
  QZH48_RS11495 (QZH48_11495) - 2338040..2338777 (-) 738 WP_021723055.1 metal ABC transporter ATP-binding protein -
  QZH48_RS11500 (QZH48_11500) - 2338955..2339797 (-) 843 WP_038602352.1 metal ABC transporter substrate-binding protein -
  QZH48_RS11505 (QZH48_11505) - 2339794..2340231 (-) 438 WP_021721874.1 zinc-dependent MarR family transcriptional regulator -
  QZH48_RS11510 (QZH48_11510) comGG 2340312..2340587 (-) 276 WP_021721873.1 hypothetical protein Machinery gene
  QZH48_RS11515 (QZH48_11515) comGF 2340635..2341060 (-) 426 WP_161935055.1 competence type IV pilus minor pilin ComGF Machinery gene
  QZH48_RS11520 (QZH48_11520) comGE 2341044..2341340 (-) 297 WP_038602356.1 competence type IV pilus minor pilin ComGE Machinery gene
  QZH48_RS11525 (QZH48_11525) comGD 2341312..2341710 (-) 399 WP_301675732.1 competence type IV pilus minor pilin ComGD Machinery gene
  QZH48_RS11530 (QZH48_11530) comGC 2341703..2342086 (-) 384 WP_080739889.1 competence type IV pilus major pilin ComGC Machinery gene
  QZH48_RS11535 (QZH48_11535) comGB 2342100..2343173 (-) 1074 WP_080739890.1 competence type IV pilus assembly protein ComGB Machinery gene
  QZH48_RS11540 (QZH48_11540) comGA 2343067..2344005 (-) 939 WP_058205111.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 91 a.a.        Molecular weight: 10539.79 Da        Isoelectric Point: 5.6623

>NTDB_id=781231 QZH48_RS11510 WP_021721873.1 2340312..2340587(-) (comGG) [Lactococcus lactis subsp. lactis strain CAB701]
MFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLFYNLLTDSSASSKTTDHLSDEKTYQFSIR
LKDGTNFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=781231 QZH48_RS11510 WP_021721873.1 2340312..2340587(-) (comGG) [Lactococcus lactis subsp. lactis strain CAB701]
ATGTTTCTTCAGTTCTATTTGCAAAGACAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACTGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGACTTAAAATCTCAAGGGCAAATTCATTTTGATTCAGGAGATTTGTTCTACA
ATTTACTGACAGACTCGTCAGCCAGTTCAAAAACTACTGATCATTTAAGCGATGAAAAAACTTATCAATTTAGTATCCGC
CTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

61.111

98.901

0.604